Identifiers and Description

Gene Model Identifier

TTHERM_01008650

Standard Name

ATR1 (Tetrahymena ATR orthologue)

Aliases

PreTt29569 | 194.m00025

Description

Phosphatidylinositol 3- and 4-kinase family protein. Sequence similarity to the ATR subfamily of the protein kinase PIKK family (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

  • ( PF07966 ) A1 Propeptide
  • ( TIGR01612 ) rhoptry protein
  • ( PF04111 ) Autophagy protein Apg6
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF07720 ) Tetratricopeptide repeat
  • ( TIGR00188 ) ribonuclease P protein component
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF00454 ) Phosphatidylinositol 3- and 4-kinase
  • ( PF08578 ) Protein of unknown function (DUF1765)
  • ( PF08050 ) Tetracycline resistance leader peptide
  • ( TIGR01602 ) Plasmodium yoelii repeat of length
  • ( TIGR00075 ) hydrogenase expression/formation protein HypD

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01008650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13561.19.997093137033517e-262phosphatidylinositol 3- and 4-
kinase (2034 aa)
OxytrichaContig19156.0.g851.999385218781115e-51Phosphatidylinositol 3- and 4-
kinase
DictyBaseDDB_G02913801.9998323414791308e-36atr1 on chromosome: 6 position
214264 to 224083
SGDYBR136W1.9998323414791308e-36MEC1 Genome integrity checkpoi
nt protein and PI kinase super
family member; signal transduc
er required for cell cycle arr
est and transcriptional respon
ses prompted by damaged or unr
eplicated DNA; monitors and pa
rticipates in meiotic recombin
ation
WormBaseWBGene000048791.000382677035467e-28locus:smg-1 Serine/threonine
-protein kinase smg-1 status
:Confirmed UniProt:O01510
protein_id:CCD67583.1
Stentor CoeruleusSteCoe_345631.0530617357553812e-20

General Information

Paragraph NoGene NameParagraph Text
80ATR1Gene Information: The phosphatidylinositol 3-kinase (PI3K)-related sensor kinase ATR is a key player in the signaling of induced DNA damage and self-inflicted DNA cuts in vegetative and meiotic cells (Richardson et al., 2004; Bassing and Alt, 2004; Hunter, 2008). In higher eukaryotes ATR is recruited by the MRX/MRN complex and possibly other unknown factors to the sites of damage and phosphorylates a host of target proteins to arrest replication forks and prevent new origins from firing. (Kurz and Lees-Miller, 2004). TTHERM_01008650 BLAST against human ATR1 NP_001175.2 e value : 6.0 e-5. Reverse BLAST of human ATR1 (NP_001175.2) against TTHERM_01008650 e value : 3e-48
17ATR1Knockout prevents SPO11-dependent elongation of meiotic nuclei. Involved in the signaling of meiotic DSBs and other DNA damage.
81ATR1Nucleic Acid Interactions: Involved in ssDNA binding at rDNA origin and promoter. Sensing and repair mechanisms unknown.
82ATR1Protein Interaction Partners: Not determined
83ATR1Biochemical Activities: Ability to arrest cell cycle is inhibited by caffeine.
84ATR1Regulation & Expression: Activated / Induced by DNA damage

Associated Literature

  1. Ref:19297526: Loidl J, Mochizuki K (2009) Tetrahymena meiotic nuclear reorganization is induced by a checkpoint kinase-dependent response to DNA damage. Molecular biology of the cell 20(9):2428-37
  2. Ref:17005912: Yakisich JS, Sandoval PY, Morrison TL, Kapler GM (2006) TIF1 activates the intra-S-phase checkpoint response in the diploid micronucleus and amitotic polyploid macronucleus of Tetrahymena. Molecular biology of the cell 17(12):5185-97
  3. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_01008650(coding)
ATGGATATAATTAAAAGATTAAAAAGCAAGGAGGCTAAGGCATCTTAGTAAAACTTCGAA
CAAGCCAATAGATTAAACAGTATAGAATAGTCGAATTAGAAGAACAGAGTTTAAGCTAAG
TAGGAAGGAATATAAGGTTCTGGATTTCTATAAGTTCAATAAAGTTTAAGTGTAAATAGA
CCTAGTTCTAGCAATAATTTGATGGATTAGACTGCATAAATACATATTTAGAAGTAGGAT
TCTAATAGTGCAAAATCAAGCAAAAGTTCTATTTCATATAATAGTGAAACTAATTATTTA
AAAATGAATGCTCAACCTTCAAACATAAAAGAGAGAGTAGAACAAATTACTGAAGAGCCA
GTTGATGAACACTTAGATTTTAAGTATTAGAAGCTGCTTGATGTGATAAAAGGGAGTGGA
GACAAAAATAATTTGGGATTTTTGTAATAAAAAATTGATTATTTAACAATGATAAGTAAC
AGACTGTAGATTAGTCTCTTTGACTTGCTGAATTTGCTTCCAAGCAAGTACCTTGCGTAA
TTGTTTTAAGATTATAAGCAATAAGAGAATGTGATGGTGAACATCATTTTAGCATCTGTT
AGTGGATTATCTTAGCCAAATAAAATATTCGAAGATATAAAAATTGATTTAGGTGATAAA
TTCGATTACGAAAATTAATATCTCAAAGCACACTGTTAAAATTATGAGGACTGTTTGAAT
TAAGATGAGTAAGAGCAGTAATCGCTTGAGGACGACGAAGAATTAGAAGAGCTGACTCCT
TAAATTAAAACAAGAATTTTCTTTAGTAGATATATAATTCCGCTTGTTTTACACTAGCTG
ATTGATTTTAAGCAAGATCCTTCGATCCAAATGAGCAGCATTCTAGGTAGACTAGAAGAT
ATCTATGGCATGCAACAATCTCAAGCATAACTTGGGAGTGCATAAAACATAAACACATAA
GATTCGGGTGGCAGTCTCTCTCAAAACTCAAATGCATCTTAAAATCTTTTCATCCAAAAA
GTTTATATAACAAATCTAAGAGAGTTTTATAGATCATTGAAGTTTTTCATGGAGAAAATA
TATAGAAAAAACAATGATAAAGCTCAATATGTTTTATCTTACTTGTAAAAAATATGCAAA
AACGAAAGAGACTATGAGCTAGATTAAACACTTTTTAGCTATGAAGATTTAAAAAGAGAT
AGAATTGTACTTTACAGATTAGCTATGAGTGGTACTAAAAAATTACTATTTAACTACCTG
TAAGACAAATAAATTCTAACCAAGTATGCTGGAAACTGTATTTTTGACTTCAAGAAAAAG
GAGATATTTTTGGATTATTACAAGAGATTCATCACACCTGCAGAAGCTTCCCTTTCTAAT
GGAATGGATGATACTGTATTTAGAATATCAGCAAATTTGGAAAATTACTGTAGAGCTCTT
CAAACTAGCTAGCATAAAATATGCGCTTTAAGAAATGCAATTGCTTTAATAAGGTTTTTA
ACTCCTTTTTTGGAGACATTTTCTTCATAATTTAATTAATCTGCCACAAATAAATACTTG
ATTAAAGCTGCATGTTGGAGAATTGTTAGATTTATTTTGTTTGTTCATGATGGAAGCATT
TCATATGTTGCTTTGGTATTTCTTATTTTTTGTTTTGAACTACTTTTCAGTGAAAGAAGT
CTTTTGAATTAAGAGCATGAGAGATTCTTACATCTTCTACTCGCATTTTTGCATGTATAT
AGAAACAGAGAGGATGCTTTGTTCAAATATTCGTAGTAAGTTGCTACAAGGATCATAATG
AAACTAATTAAAAAGATAAATTATAACAGTTCAGGTGACTCCTCTTCTTTGTCTTCATCC
AGAAAGAAAATAAATATTCAAACTTCGTCTAAAAGCAGCAGCAATTCTACTAATAACTCT
GATCTAGACTAAAGTCATCAAATGAAAGACTACTGGTTTTTAAATTACAACTATCATAGT
TTGGATGAAAAGTTTTAGAAATATTTCGCTTACATTTCACAAAAAGACATTTATAGCAAA
TATAATTATATAGAAAAAGAACTTAAATAAATCCAAGAATAACCACTTATCGATGAATAA
GTTATTTTAATCTTATCGTATTTAAAGAATTTGCTGCAGGAGCCTTAAGATTTTACTCAA
ATTAAAATTTCAAAAAGTATGTAAGAAGAACTAAAAAGTAAAAACTTAAATGAGATACAA
TTGAAAAAAGAAAAAGAAAAGCTTTCATTGATTCACTTGTAAAAGATTAAAGAAAAGAAA
AATGCAATTTATTTACAGTTGCTCAATTTGCCAAAGCTTTCTGATAATAAAAAGATTCTT
GCAAAGAATAGTCACTCAATGAATGCTCTTGTAAAAATAAAGTAGGAGCTATTAGTGGAT
TGTCTTGGCTTAATTGGGCCAGTATAACAGCATGACTTTCAGGAGAATTACTAAGATATC
CTCCCAATCAACCTCACACCTGCTGATCTAAAAGAAAAAATAAAATCATTTTTAAATGTC
AATATCTTTAACACAGACATACCTCTAGTTTCTCTCTGTATTTGCAAAGAGTACGTAGAA
AATAAATTCACAGGCAAAAGAAAAAAACTAAATGAGAGAATTTAAAATAGCTTTTTGAGT
GCAAACGAAGCAAGTAAATCTCAAGATGATATGGAAGAAAGATCTAACATGCTGAATGCA
TCTTTTAGCTCAAGAGGAATAAATGAAAATACAAATGGAAATGCTACTAATTTAGATCAC
AGTATTATTCACCAATAAAAGCAATAGTTTAATCTTATGCAATGGCTAGCAGAGCTGATT
ATGAAGATGAAAAAGTAGGATGAAACCATTAAAATTATTGAGGGATGCATGGAACTAATG
GCAAACAGTGACTTAGGAGAGTTTTTAACTCCTTATATAATCTTCAAATATATCAATAGC
ACAGAAAATAGTCATTTAGAAATTATCCCAGTTATAAACAAGATATTAGAAGAAGGCCAT
CACAATCACAAGTTAATTATAACCAAAACACTCATCAACTTAGACACTTGGTTCAGGTAA
GAGCTCAAATAGGAAAAATAATAAAATTATGACCCTTTCAGACCACAAAGTATTATGCAT
TCAGAATCTCCAAAAAATAGATTTATAAGAAATTTTGCATTCATAAAGAGAGGTATTTCT
ACATAGGTGTATTGCAAAACGTTAGTTGAAATGAGTGAGCATAAAGGTGCTATTTAACTG
CTTGAATAAGAACTAGAATAATAAGATATATAATTATTGAACCTCACTGACGCTTAGGAG
ATCAAGAATATAAAAAAGCTTAGAACACATTACATTTATCAATTATATAATATTTATAAA
GAAGTGAATGAAGATTATAAAAATATTGATGTAGTTGAAATGATGAGAAAATTAGATTTA
GATGAAACAGAAATCAAGAAATACCAAGATATTAATTTAAAGCAGAAAAATGATGGTTTA
TGCCCAGAAATATACGAAGATATTGTGGATAGAAATTTTAGAGATGAAGAATCCTAATAA
AAATTAATTAATTTGCTTTCCAAAAGCATTCCAGATTTTGCATCTTAGAATTAAGATTTT
GCATTTTAGAAATATTTGAGAAGCATCTGCTGGGGATTTTAAAAGATATTGAACTATGAA
AAAAATAACAGCTTTGACAATATGTTTTAGTAATTAAAATCTGCAATTCAAAAATTGAAA
TATGCTTTCAGTTTACAATTAGTTAACGCAAAATGTTGTTATGACAGTAAATTTTCGGTA
TTAGTAAAGATTTAGGTGCTTTTAAATGTTGAAACAATGCTAAAAATATAAAAATTTTAA
AAAGACTACTCAAAGTTGGCTAAAAATGGAGATATTATTTTCGATTAGACTTCTTTCTCT
TTTGATGAATCTTAACCAGATTATCTTCTCAAATTAACTGTTAAATCTAATTCCCAAGGA
TTTCCAAACAATAATACTTCCTCTTTAGGTGGTAGTCGTATTACATACAACTAAATAATA
AACTAGTATTCTGTTTTTAACTTAATTCAAGCTCTGTAATAGACTTCTAAGTTGTTACTC
AGTTATGATTAAGAGTGCTATTTAAGAATAGTTTACAATTATTTAATATGCGTCCTATAC
AACTAATGCAAAGAATACAGAAAAATTTACATAAATTCTTTGTTTAGACTCTCCAAATAC
TACTATAAAAAAGAAAAATACTCTGATGCTTTAACTATTTTGAAGAGAGCTAAATAGGTT
TGGAAGGAAAAAAAAGATTCATTTTCTTCTTAGGAAATATACACTCTTTAGGCAAAGATT
GAAAAGAAACTGGGAAATATAAAGAAAGCTATTCATAAGCTATAAAAATTTGATGGAATT
GATTTTAAAATAAAGAAAGTTACTTATAAATATCAACATAATTTCTAGATTTTCTCTGAG
TCTTTAATCCACAGCGAGTTTATTAAGTTAGTTCAGTAAAATTCTGAAAGTGAGAAATTG
TGTTTCAAGTATGCAAAGTTTATAGATGAAAATGAATTAATATCAGACAACCCTAATGAC
AAAGAGATTGACCAAAAAATAAAAGCTATTTAGCTCTATCTCTTAGCAGCATCAAATGGA
CATTAATACATTCATCAGTCTCTTCCAAGAGCAATACGCTTGCTAGTAGAACTTTTTTAG
GATGTGGCAAATTTGTAAACTAAAAAAGCTCAGCTTGTCAAGCAAAAATTTGACAAAAAT
TTCTTATAAATATCCGAAACTTGCAATAAAATAGAAACCTTCAAATTAACCAGTGTTGTC
AATCAGCTAACCTCGCATATCACAATACCTTATTAGTAGTGTGCTAATTTATTTATTGAT
CTCCTGGCAAAAGTAGGTGCTGAATATCCTGACTAAAGTGTCTGGTGGTTATTACCTCTT
AAATACATGTACTAAATGATTAGCAATTAAAGCTCTGTGCAAAAGGATGAATATACTGAA
TAAAGAGCTTCTGCTATTCTTAAAAAGATTAATGAAATAAATCCATCAAGTTATGAACAA
ATAAATAGAGTTTCTAACTTCTACTACAATTTATTAAATTTTGCAATTAAAGCGCCAGAC
GGATCTAGTACTACTATGAAAATCGAAAACTACTTGGTAAAATCACTGGCTAACCTGAGA
CTGATTCTTCCCAAAAAGGAATACATTTTCCCAAAGATGCCATAAAGCAGAAATGTAGAA
CCTAATTATAATCCTTACCATAATAATCCAGTATACATGGAAAAGTTTGATGATGTTGTC
AGAATTATGAGCTCCAAACAAAAACCAAAACTCTTAACTGTTTAATGTTCTGATGGAACT
AAAAAGAAATTTTTAATCAAATCTCAAACTCAAAGTGAAAATGTCTACGAGCAGAGAACA
AGTGAGTTGATTTCATTCTTGAACCTTATTCTTTACAAAGAATAACTTGGATTTTATGAA
ATGCCTTCTTATACAATTCTAAGATTAAACAGCTAAAGCTGCATTGTAGAATGGGTTGAT
GATACACTAACTTTAAAGACGATTTTAGATTAGCTGTGGTAAGAGAAGAAGCAAAAGAGC
TAGTTCTATTAATTAAAACTAGACTCAGATAAATTAAGCAGAGAAGAATGGAATAAACAA
AAGAGCCTTCCTTCTGTATTTTAAGACTTCTTCAACTAACGATTCCTTGATTCTTAATAA
TGGTACACAGCAAAAGAAAACTACTTGAGGACTTATGCATCATGGTGCATATTAGGCTAT
CTTATTGGACTTGGAGATAGACACACTGATAATATATTAATTAAAAAAATTAATGGTGAA
ATAGTCCATATTGACTACGCTCTTATCTTTGGTTCAGGTAAATAGCTTAATGTTCCAGAA
ACTATTCCATTTAGATTAACAAAAAATATGGAATTTGCTTTGGGTTCTTTCAAGTCTTAT
GGTCTCTTTAGAAAAGCCATGATAGACATTTGTATGTGTTTCTCAAAACATTTGGATGAT
ATCATTGGCTTTTGGGATTGCTTTACCAACGAACTAGAGGGATGTAAAAAAACAAACTTT
AACCAGCTATGCAATCAAATTAAGAATAGAATTAAAATGACTAACTTTAAATCAACTGAA
GAAGGCATAGACAGTCTTATTTAGATCTCTAAAGACGATTATTGTCTAAGAGACATGTTC
AAAGGCTGGTGGCCTCATGCATGA


>TTHERM_01008650(protein)
MDIIKRLKSKEAKASQQNFEQANRLNSIEQSNQKNRVQAKQEGIQGSGFLQVQQSLSVNR
PSSSNNLMDQTAQIHIQKQDSNSAKSSKSSISYNSETNYLKMNAQPSNIKERVEQITEEP
VDEHLDFKYQKLLDVIKGSGDKNNLGFLQQKIDYLTMISNRLQISLFDLLNLLPSKYLAQ
LFQDYKQQENVMVNIILASVSGLSQPNKIFEDIKIDLGDKFDYENQYLKAHCQNYEDCLN
QDEQEQQSLEDDEELEELTPQIKTRIFFSRYIIPLVLHQLIDFKQDPSIQMSSILGRLED
IYGMQQSQAQLGSAQNINTQDSGGSLSQNSNASQNLFIQKVYITNLREFYRSLKFFMEKI
YRKNNDKAQYVLSYLQKICKNERDYELDQTLFSYEDLKRDRIVLYRLAMSGTKKLLFNYL
QDKQILTKYAGNCIFDFKKKEIFLDYYKRFITPAEASLSNGMDDTVFRISANLENYCRAL
QTSQHKICALRNAIALIRFLTPFLETFSSQFNQSATNKYLIKAACWRIVRFILFVHDGSI
SYVALVFLIFCFELLFSERSLLNQEHERFLHLLLAFLHVYRNREDALFKYSQQVATRIIM
KLIKKINYNSSGDSSSLSSSRKKINIQTSSKSSSNSTNNSDLDQSHQMKDYWFLNYNYHS
LDEKFQKYFAYISQKDIYSKYNYIEKELKQIQEQPLIDEQVILILSYLKNLLQEPQDFTQ
IKISKSMQEELKSKNLNEIQLKKEKEKLSLIHLQKIKEKKNAIYLQLLNLPKLSDNKKIL
AKNSHSMNALVKIKQELLVDCLGLIGPVQQHDFQENYQDILPINLTPADLKEKIKSFLNV
NIFNTDIPLVSLCICKEYVENKFTGKRKKLNERIQNSFLSANEASKSQDDMEERSNMLNA
SFSSRGINENTNGNATNLDHSIIHQQKQQFNLMQWLAELIMKMKKQDETIKIIEGCMELM
ANSDLGEFLTPYIIFKYINSTENSHLEIIPVINKILEEGHHNHKLIITKTLINLDTWFRQ
ELKQEKQQNYDPFRPQSIMHSESPKNRFIRNFAFIKRGISTQVYCKTLVEMSEHKGAIQL
LEQELEQQDIQLLNLTDAQEIKNIKKLRTHYIYQLYNIYKEVNEDYKNIDVVEMMRKLDL
DETEIKKYQDINLKQKNDGLCPEIYEDIVDRNFRDEESQQKLINLLSKSIPDFASQNQDF
AFQKYLRSICWGFQKILNYEKNNSFDNMFQQLKSAIQKLKYAFSLQLVNAKCCYDSKFSV
LVKIQVLLNVETMLKIQKFQKDYSKLAKNGDIIFDQTSFSFDESQPDYLLKLTVKSNSQG
FPNNNTSSLGGSRITYNQIINQYSVFNLIQALQQTSKLLLSYDQECYLRIVYNYLICVLY
NQCKEYRKIYINSLFRLSKYYYKKEKYSDALTILKRAKQVWKEKKDSFSSQEIYTLQAKI
EKKLGNIKKAIHKLQKFDGIDFKIKKVTYKYQHNFQIFSESLIHSEFIKLVQQNSESEKL
CFKYAKFIDENELISDNPNDKEIDQKIKAIQLYLLAASNGHQYIHQSLPRAIRLLVELFQ
DVANLQTKKAQLVKQKFDKNFLQISETCNKIETFKLTSVVNQLTSHITIPYQQCANLFID
LLAKVGAEYPDQSVWWLLPLKYMYQMISNQSSVQKDEYTEQRASAILKKINEINPSSYEQ
INRVSNFYYNLLNFAIKAPDGSSTTMKIENYLVKSLANLRLILPKKEYIFPKMPQSRNVE
PNYNPYHNNPVYMEKFDDVVRIMSSKQKPKLLTVQCSDGTKKKFLIKSQTQSENVYEQRT
SELISFLNLILYKEQLGFYEMPSYTILRLNSQSCIVEWVDDTLTLKTILDQLWQEKKQKS
QFYQLKLDSDKLSREEWNKQKSLPSVFQDFFNQRFLDSQQWYTAKENYLRTYASWCILGY
LIGLGDRHTDNILIKKINGEIVHIDYALIFGSGKQLNVPETIPFRLTKNMEFALGSFKSY
GLFRKAMIDICMCFSKHLDDIIGFWDCFTNELEGCKKTNFNQLCNQIKNRIKMTNFKSTE
EGIDSLIQISKDDYCLRDMFKGWWPHA


>TTHERM_01008650(gene)
ATGGATATAATTAAAAGATTAAAAAGCAAGGAGGCTAAGGCATCTTAGTAAAACTTCGAA
CAAGCCAATAGATTAAACAGTATAGAATAGTCGAATTAGAAGAACAGAGTTTAAGCTAAG
TAGGAAGGAATATAAGGTTCTGGATTTCTATAAGTTCAATAAAGTTTAAGTGTAAATAGA
CCTAGTTCTAGCAATAATTTGATGGATTAGACTGCATAAATACATATTTAGAAGTAGGAT
TCTAATAGTGCAAAATCAAGCAAAAGTTCTATTTCATATAATAGTGAAACTAATTATTTA
AAAATGAATGCTCAACCTTCAAACATAAAAGAGAGAGTAGAACAAATTACTGAAGAGCCA
GTTGATGAACACTTAGATTTTAAGTATTAGAAGCTGCTTGATGTGATAAAAGGGAGTGGA
GACAAAAATAATTTGGGATTTTTGTAATAAAAAATTGATTATTTAACAATGATAAGTAAC
AGACTGTAGATTAGTCTCTTTGACTTGCTGAATTTGCTTCCAAGCAAGTACCTTGCGTAA
TTGTTTTAAGATTATAAGCAATAAGAGAATGTGATGGTGAACATCATTTTAGCATCTGTT
AGTGGATTATCTTAGCCAAATAAAATATTCGAAGATATAAAAATTGATTTAGGTGATAAA
TTCGATTACGAAAATTAATATCTCAAAGCACACTGTTAAAATTATGAGGACTGTTTGAAT
TAAGATGAGTAAGAGCAGTAATCGCTTGAGGACGACGAAGAATTAGAAGAGCTGACTCCT
TAAATTAAAACAAGAATTTTCTTTAGTAGATATATAATTCCGCTTGTTTTACACTAGCTG
ATTGATTTTAAGCAAGATCCTTCGATCCAAATGAGCAGCATTCTAGGTAGACTAGAAGAT
ATCTATGGCATGCAACAATCTCAAGCATAACTTGGGAGTGCATAAAACATAAACACATAA
GATTCGGGTGGCAGTCTCTCTCAAAACTCAAATGCATCTTAAAATCTTTTCATCCAAAAA
GTTTATATAACAAATCTAAGAGAGTTTTATAGATCATTGAAGTTTTTCATGGAGAAAATA
TATAGAAAAAACAATGATAAAGCTCAATATGTTTTATCTTACTTGTAAAAAATATGCAAA
GTAAGCAATTTCTTTTAAAATCCAACAAATTTATTTTAAAAACAGAAAAAGTAGTGACAA
ATTTAGTATAAATTTAATTGTTTTATTTTGATAATTCATTTAAAATAATTAATGATAAAA
TTCTTTTTTTTTTGAATTTAGAACGAAAGAGACTATGAGCTAGATTAAACACTTTTTAGC
TATGAAGATTTAAAAAGAGATAGAATTGTACTTTACAGATTAGCTATGAGTGGTACTAAA
AAATTACTATTTAACTACCTGTAAGACAAATAAATTCTAACCAAGTATGCTGGAAACTGT
ATTTTTGACTTCAAGAAAAAGGAGATATTTTTGGATTATTACAAGAGATTCATCACACCT
GCAGAAGCTTCCCTTTCTAATGGAATGGATGATACTGTATTTAGAATATCAGCAAATTTG
GAAAATTACTGTAGAGCTCTTCAAACTAGCTAGCATAAAATATGCGCTTTAAGAAATGCA
ATTGCTTTAATAAGGTTTTTAACTCCTTTTTTGGAGACATTTTCTTCATAATTTAATTAA
TCTGCCACAAATAAATACTTGATTAAAGCTGCATGTTGGAGAATTGTTAGATTTATTTTG
TTTGTTCATGATGGAAGCATTTCATATGTTGCTTTGGTATTTCTTATTTTTTGTTTTGAA
CTACTTTTCAGTGAAAGAAGTCTTTTGAATTAAGAGCATGAGAGATTCTTACATCTTCTA
CTCGCATTTTTGCATGTATATAGAAACAGAGAGGATGCTTTGTTCAAATATTCGTAGTAA
GTTGCTACAAGGATCATAATGAAACTAATTAAAAAGATAAATTATAACAGTTCAGGTGAC
TCCTCTTCTTTGTCTTCATCCAGAAAGAAAATAAATATTCAAACTTCGTCTAAAAGCAGC
AGCAATTCTACTAATAACTCTGATCTAGACTAAAGTCATCAAATGAAAGACTACTGGTTT
TTAAATTACAACTATCATAGTTTGGATGTAAATTTACATATAAAAAAATAATTTTAAATA
TTTTATCATGAATAAAATTAGGAAAAGTTTTAGAAATATTTCGCTTACATTTCACAAAAA
GACATTTATAGCAAATATAATTATATAGAAAAAGAACTTAAATAAATCCAAGAATAACCA
CTTATCGATGAATAAGTTATTTTAATCTTATCGTATTTAAAGAATTTGCTGCAGGAGCCT
TAAGATTTTACTCAAATTAAAATTTCAAAAAGTATGTAAGAAGAACTAAAAAGTAAAAAC
TTAAATGAGATACAATTGAAAAAAGAAAAAGAAAAGCTTTCATTGATTCACTTGTAAAAG
ATTAAAGAAAAGAAAAATGCAATTTATTTACAGTTGCTCAATTTGCCAAAGCTTTCTGAT
AATAAAAAGATTCTTGCAAAGAATAGTCACTCAATGAATGCTCTTGTAAAAATAAAGTAG
GAGCTATTAGTGGATTGTCTTGGCTTAATTGGGCCAGTATAACAGCATGACTTTCAGGAG
AATTACTAAGATATCCTCCCAATCAACCTCACACCTGCTGATCTAAAAGAAAAAATAAAA
TCATTTTTAAATGTCAATATCTTTAACACAGACATACCTCTAGTTTCTCTCTGTATTTGC
AAAGAGTACGTAGAAAATAAATTCACAGTAAAAAAAAATTAAATTTGAAAAAAATGAATT
GAATTGAAATTAATTTTGTTAATTAATTAATTATAAAAAGGGCAAAAGAAAAAAACTAAA
TGAGAGAATTTAAAATAGCTTTTTGAGTGCAAACGAAGCAAGTAAATCTCAAGATGATAT
GGAAGAAAGATCTAACATGCTGAATGCATCTTTTAGCTCAAGAGGAATAAATGAAAATAC
AAATGGAAATGCTACTAATTTAGATCACAGTATTATTCACCAATAAAAGCAATAGTTTAA
TCTTATGCAATGGCTAGCAGAGCTGATTATGAAGATGAAAAAGTAGGATGAAACCATTAA
AATTATTGAGGGATGCATGGAACTAATGGCAAACAGTGACTTAGGAGAGTTTTTAACTCC
TTATATAATCTTCAAATATATCAATAGCACAGAAAATAGTCATTTAGAAATTATCCCAGT
TATAAACAAGATATTAGAAGAAGGCCATCACAATCACAAGTTAATTATAACCAAAACACT
CATCAACTTAGACACTTGGTTCAGGTAAGAGCTCAAATAGGAAAAATAATAAAATTATGA
CCCTTTCAGACCACAAAGTATTATGCATTCAGAATCTCCAAAAAATAGATTTATAAGAAA
TTTTGCATTCATAAAGGTATTTATTCTAATTTATATTAATATATTAATTATTTTTGCCTT
TTTAGAGGAAAAATTTGCAAATTATTAATTGTGTTTTAAAAATAAATTTAGAGAGGTATT
TCTACATAGGTGTATTGCAAAACGTTAGTTGAAATGAGTGAGCATAAAGGTGCTATTTAA
CTGCTTGAATAAGAACTAGAATAATAAGATATATAATTATTGAACCTCACTGACGCTTAG
GAGATCAAGAATATAAAAAAGCTTAGAACACATTACATTTATCAATTATATAATATTTAT
AAAGAAGTGAATGAAGATTATAAAAATATTGATGTAGTTGAAATGATGAGAAAATTAGAT
TTAGGTAAATAATTAAAAATTTCTATTAAATACTTTTACAAATAAATAAATCCTTTCTTA
TAAAATAGATGAAACAGAAATCAAGAAATACCAAGATATTAATTTAAAGCAGAAAAATGA
TGGTTTATGCCCAGAAATATACGAAGATATTGTGGATAGAAATTTTAGAGATGAAGAATC
CTAATAAAAATTAATTAATTTGCTTTCCAAAAGCATTCCAGATTTTGCATCTTAGAATTA
AGATTTTGCATTTTAGAAATATTTGAGAAGCATCTGCTGGGGATTTTAAAAGATATTGAA
CTATGAAAAAAATAACAGCTTTGACAATATGTTTTAGTAATTAAAATCTGCAATTCAAAA
ATTGAAATATGCTTTCAGTTTACAATTAGTTAACGCAAAATGTTGTTATGACAGTAAATT
TTCGGTATTAGTAAAGATTTAGGTGCTTTTAAATGTTGAAACAATGCTAAAAATATAAAA
ATTTTAAAAAGACTACTCAAAGTTGGCTAAAAATGGAGATATTATTTTCGATTAGACTTC
TTTCTCTTTTGATGAATCTTAACCAGATTATCTTCTCAAATTAACTGTTAAATCTAATTC
CCAAGGATTTCCAAACAATAATACTTCCTCTTTAGGTGGTAGTCGTATTACATACAACTA
AATAATAAACTAGTATTCTGTTTTTAACTTAATTCAAGCTCTGTAATAGACTTCTAAGTT
GTTACTCAGTTATGATTAAGAGTGCTATTTAAGAATAGTTTACAATTATTTAATATGCGT
CCTATACAACTAATGCAAAGAATACAGAAAAATTTACATAAATTCTTTGTTTAGACTCTC
CAAATACTACTATAAAAAAGGTAAAAATAAATATTTACAAAAAATTATTATAATTTTTTA
ATTTAAAGCAAATATTTTTAATTCAATAAAAAATAAATAAAATTAAAAATAAAGTAAAAT
TTAAAACAAAAAATACTTATTGTCAATAAAAAATTAATTTACAAATAATTTAAATTTTTT
ATGAAATTTTAATTTTAGCAAATTAATTATTTGTCAGTTATAGATATTAAATATTATAGA
AAAATAATTAAGATATGATAATAAAGTTTTAAACATGAAATAAAATTAATTTAACTAAAA
TATTTAAAACCTTAAAAAGAAAAATACTCTGATGCTTTAACTATTTTGAAGAGAGCTAAA
TAGGTTTGGAAGGAAAAAAAAGATTCATTTTCTTCTTAGGAAATATACACTCTTTAGGCA
AAGATTGAAAAGAAACTGGGAAATATAAAGAAAGCTATTCATAAGCTATAAAAATTTGAT
GGAATTGATTTTAAAATAAAGAAAGTTACTTATAAATATCAACATAATTTCTAGATTTTC
TCTGAGTCTTTAATCCACAGCGAGTTTATTAAGTTAGTTCAGTAAAATTCTGAAAGTGAG
AAATTGTGTTTCAAGTATGCAAAGTTTATAGATGAAAATGAATTAATATCAGACAACCCT
AATGACAAAGAGATTGACCAAAAAATAAAAGCTATTTAGCTCTATCTCTTAGCAGCATCA
AATGGACATTAATACATTCATCAGTCTCTTCCAAGAGCAATACGCTTGCTAGTAGAACTT
TTTTAGGATGTGGCAAATTTGTAAACTAAAAAAGCTCAGCTTGTCAAGCAAAAATTTGAC
AAAGTAAAATTCATTTTTCATTTTATCTTTATAAAAATAATTAAAATATTTTTAAATAAT
AAAATTAAGAATTTCTTATAAATATCCGAAACTTGCAATAAAATAGAAACCTTCAAATTA
ACCAGTGTTGTCAATCAGCTAACCTCGCATATCACAATACCTTATTAGTAGTGTGCTAAT
TTATTTATTGATCTCCTGGCAAAAGTAGGTAATGAATGCTTTCAAATAAACAAATAACTA
AAAGAATATATTTAAATATTACCATAAATAGACATTAAATTATAGCTTTTAATATTCTTT
AACTAACTTTTATATTTAAAATCAAAATAATTAATTAGGTGCTGAATATCCTGACTAAAG
TGTCTGGTGGTTATTACCTCTTAAATACATGTACTAAATGATTAGCAATTAAAGCTCTGT
GCAAAAGGATGAATATACTGAATAAAGAGCTTCTGCTATTCTTAAAAAGATTAATGAAAT
AAATCCATCAAGTTATGAACAAATAAATAGAGTTTCTAACTTCTACTACAATTTATTAAA
TTTTGCAATTAAAGCGCCAGACGTAAATATTCAATTTCTCTCTGATAAATTATTCTTTTT
TTATATCTTGAAATTAAATATTATTTTTAATGCCTAACCAACTAATCTACTTTAAATATA
GGGATCTAGTACTACTATGAAAATCGAAAACTACTTGGTAAAATCACTGGCTAACCTGAG
ACTGATTCTTCCCAAAAAGGAATACATTTTCCCAAAGATGCCATAAAGCAGAAATGTAGA
ACCTAATTATAATCCTTACCATAATAATCCAGTATACATGGAAAAGTTTGATGATGTTGT
CAGAATTATGAGCTCCAAACAAAAACCAAAACTCTTAACTGTTTAATGTTCTGATGGAAC
TAAAAAGAAATTTTTAATCAAATCTCAAACTCAAAGTGAAAATGTCTACGAGCAGAGAAC
AAGTGAGTTGATTTCATTCTTGAACCTTATTCTTTACAAAGAATAACTTGGATTTTATGA
AATGCCTTCTTATACAATTCTAAGATTAAACAGCTAAAGGTAATAATTAATTAATTAATT
AATACATTTCAATTCATATTTTTATAATTTTATTATTAAATTGAAAAATTCATTACTATA
AATTATTAATATTACTTAAAAAATACTTCACAGCTGCATTGTAGAATGGGTTGATGATAC
ACTAACTTTAAAGACGATTTTAGATTAGCTGTGGTAAGAGAAGAAGCAAAAGAGCTAGTT
CTATTAATTAAAACTAGACTCAGATAAATTAAGCAGAGAAGAATGGAATAAACAAAAGAG
CCTTCCTTCTGTATTTTAAGACTTCTTCAACTAACGATTCCTTGATTCTTAATAATGGTA
CACAGCAAAAGAAAACTACTTGAGGACTTATGCATCATGGTGCATATTAGGCTATCTTAT
TGGACTTGGAGATAGACACACTGATAATATATTAATTAAAAAAATTAATGGTGAAATAGT
CCATATTGACTACGCTCTTATCTTTGGTTCAGGTAAATAGCTTAATGTTCCAGAAACTAT
TCCATTTAGATTAACAAAAAATATGGAATTTGCTTTGGGTTCTTTCAAGTCTTATGGTCT
CTTTAGAAAAGCCATGATAGACATTTGTATGTGTTTCTCAAAACATTTGGATGATATCAT
TGGCTTTTGGGATTGCTTTACCAACGAACTAGAGGGATGTAAAAAAACAAACTTTAACCA
GCTATGCAATCAAATTAAGAATAGAATTAAAATGACTAACTTTAAATCAACTGAAGAAGG
CATAGACAGTCTTATTTAGATCTCTAAAGACGATTATTGTCTAAGAGACATGTTCAAAGG
CTGGTGGCCTCATGCATGA