Identifiers and Description

Gene Model Identifier

TTHERM_00585260

Standard Name

ATP2 (ATP synthase 2)

Aliases

PreTt04132 | 80.m00178 | 3675.m00076

Description

ATP synthase beta chain, mitochondrial precursor, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, catalytic domain (IEA) | GO:0033178
  • proton-transporting two-sector ATPase complex (IEA) | GO:0016469

Molecular Function

  • hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances (IEA) | GO:0016820
  • proton-transporting ATPase activity, rotational mechanism (IEA) | GO:0046961
  • proton-transporting ATP synthase activity, rotational mechanism (IEA) | GO:0046933

Biological Process

Domains

  • ( PF08477 ) Miro-like protein
  • ( TIGR01026 ) ATPase FliI/YscN family
  • ( PF00306 ) ATP synthase ab C terminal
  • ( TIGR01040 ) V-type ATPase, B subunit
  • ( TIGR01042 ) V-type ATPase, A subunit
  • ( TIGR01039 ) ATP synthase F1, beta subunit
  • ( TIGR00962 ) ATP synthase F1, alpha subunit
  • ( TIGR01041 ) ATP synthase archaeal, B subunit
  • ( TIGR01043 ) ATP synthase archaeal, A subunit
  • ( TIGR00767 ) transcription termination factor Rho
  • ( TIGR02545 ) flagellar protein export ATPase FliI
  • ( TIGR03305 ) alternate F1F0 ATPase, F1 subunit
  • ( TIGR02782 ) P-type conjugative transfer ATPase TrbB
  • ( TIGR03324 ) alternate F1F0 ATPase, F1 subunit
  • ( PF02874 ) ATP synthase alpha/beta family, beta-barrel
  • ( PF00006 ) ATP synthase alpha/beta family, nucleotide-binding
  • ( TIGR02546 ) type III secretion apparatus H+-transporting

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.9%

TetraMine Data

TTHERM_00585260

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_215100
WormBaseWBGene000002299.997093137033517e-262locus:atp-2 ATP synthase sub
unit beta, mitochondrial sta
tus:Confirmed UniProt:P46561
protein_id:CCD66650.1
Tetrahymena borealisEI9_15185.19.997093137033517e-262ATP synthase beta chain (496 a
a)
DictyBaseDDB_G02699169.997093137033517e-262atp5b on chromosome: 1 positio
n 3855247 to 3857504
OxytrichaContig8531.0.g599.997093137033517e-262ATP synthase alpha/beta family
, nucleotide-binding domain
SGDYJR121W9.997093137033517e-262ATP2 Beta subunit of the F1 se
ctor of mitochondrial F1F0 ATP
synthase, which is a large, e
volutionarily conserved enzyme
complex required for ATP synt
hesis; phosphorylated

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00585260(coding)
ATGCTCTCTAAGGCTCTCCAAAGGGGTATTGCTAGGGCTTTCAGCACCACTGCTAAGAAG
GAAGCTCCTAAGACTGTTAAGGCCAATGGTCAAGTATCTTAGGTTATCGGTGCCGTCGTC
GATGTCCAATTCGAAGGTGAATTACCTTAAATCTTGAACGCATTAGAAGTTCAAGGAACT
TAACATAGATTGGTTTTGGAAGTTGCTTAACACTTGGGTGACTCTAGAGTCAGAACAATT
GCTATGGACAGTACTGAAGGTTTGGTCAGAGGTTAGCCCGTCGTTGATACTGGTTTACCC
ATTTCCGTCCCTGTCGGTCCTGGTACTCTTGGTCGTATCATGAACGTTATTGGTGAACCC
ATCGATTAAAGAGGTCCCATTAAGGCTGCTAAGCTCTATCCTATCCACAGAGATGCTCCC
TCTTTCACTGATTAAGCTACTTCTGCTGAAATTTTGGTTACTGGTATTAAGGTCGTCGAT
TTATTGGCTCCTTACGCTAGAGGTGGTAAGATTGGTCTTTTCGGTGGTGCTGGTGTCGGT
AAGACTGTGCTCATTCAAGAACTTATCAACAACGTTGCTAAGCATCACGGTGGTTACTCC
GTCTTCGCTGGTGTCGGTGAAAGAACCAGAGAAGGTAACGATCTCTATCATGAAATGATG
GACTCTAAGGTCATCAGTGTTAAGGAAGGTGAATCCAGATGTGCCCTCATCTTCGGTTAA
ATGAACGAACCCCCAGGTGCCAGAGCTAGAGTCGGTTTAACTGGTCTTACCGTCGCTGAA
TATTTCAGAGATGAAGAAGGTAAGGATGTCTTGCTTTTCGTCGACAATATCTTCAGATTC
ACTCAAGCCTGTTCTGAAGTGTCTGCCTTGTTGGGTCGTATTCCTTCTGCTGTCGGTTAT
CAACCTACCCTCGCTACCGATTTGGGTGCTTTATAAGAAAGAATTACCACCACCCAAAAG
GGTTCCATTACTTCCGTCCAAGCTATTTACGTACCTGCTGATGATTTGACCGATCCCGCT
CCCGCTACTACATTCGCTCACTTGGATGCTACTACTGTGCTTAACAGAGGTTTGACCGAA
TTAGGTATCTATCCTGCCGTCGATCCTTTGGATTCTACCTCCAGAATGTTAGACCCCATC
ACCATTGGTGAAGAACATTACACTGTTGCAAGAGGTGTCTAAAAGTTACTCCAAGATTAC
AAGTCACTTCAAGATATTATTGCCATTTTGGGTGTTGATGATCTTTCTGAAGAAGATAAG
CTCGTCGTCGCCAGAGCTAGAAAGGTCCAAAAGTTCCTTTCTCAACCTTTCTTCATGTCT
GAAGTTTTCTCTGGTATTCCCGGTAGATTCGTTAACCTTAAATAAAATATCGCTTCTTTC
AAGGCTCTCTTGGAAGGTGCTGGTGATGAATATCCTGAAAGTTGTTTCTACATGAAGGGT
GACCTCGAAGAATCTTTGGCTGCTGGTAGAGCTGATGCCTTAAAGTCTAAGTGA


>TTHERM_00585260(protein)
MLSKALQRGIARAFSTTAKKEAPKTVKANGQVSQVIGAVVDVQFEGELPQILNALEVQGT
QHRLVLEVAQHLGDSRVRTIAMDSTEGLVRGQPVVDTGLPISVPVGPGTLGRIMNVIGEP
IDQRGPIKAAKLYPIHRDAPSFTDQATSAEILVTGIKVVDLLAPYARGGKIGLFGGAGVG
KTVLIQELINNVAKHHGGYSVFAGVGERTREGNDLYHEMMDSKVISVKEGESRCALIFGQ
MNEPPGARARVGLTGLTVAEYFRDEEGKDVLLFVDNIFRFTQACSEVSALLGRIPSAVGY
QPTLATDLGALQERITTTQKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLNRGLTE
LGIYPAVDPLDSTSRMLDPITIGEEHYTVARGVQKLLQDYKSLQDIIAILGVDDLSEEDK
LVVARARKVQKFLSQPFFMSEVFSGIPGRFVNLKQNIASFKALLEGAGDEYPESCFYMKG
DLEESLAAGRADALKSK


>TTHERM_00585260(gene)
ATGCTCTCTAAGGCTCTCCAAAGGGGTATTGCTAGGGGTAAATATTTATAACAATTAAGA
AAAAATGTGGATTCATCAATATCGGAATGGTGAATCAAAATCAGCTAACACAAAAGCTTT
CCAAAAGTAGTTGTAAAGTTGATAGAGGAGTAATTGTTTTTGTTGTAAAAGCTAGCTTCG
ATCTGCGTTGCAACTTATGTGTTAGCTGCATTTATTGAATTCTTTTAGATTCATTCATAT
TGTGATTCACCATTCGATAAAAATAAATTTACTAACTTATTTAGTCACAAAATGGCAATA
AACTATTTAAAATAATAGCTTTCAGCACCACTGCTAAGAAGGAAGCTCCTAAGACTGTTA
AGGCCAATGGTCAAGTATCTTAGGTTATCGGTGCCGTCGTCGATGTCCAATTCGAAGGTG
AATTACCTTAAATCTTGAACGCATTAGAAGTTCAAGGAACTTAACATAGATTGGTTTTGG
AAGTTGCTTAACACTTGGGTGACTCTAGAGTCAGAACAATTGCTATGGACAGTACTGAAG
GTTTGGTCAGAGGTTAGCCCGTCGTTGATACTGGTTTACCCATTTCCGTCCCTGTCGGTC
CTGGTACTCTTGGTCGTATCATGAACGTTATTGGTAAAATAATTATTCAACTAATTATTA
TCCATATAAAAAAATAAATTCACTCATCATTCATTATCTCATCACCTAACAAACAAATAC
TTCTTGGTGAGTATTAATATACTCTAAACTTTCGATCATCCATCTATCCATCCATCATGA
AACATCTCAATCATTAATAAACTTAGTTAGGATACACAAAGCATTGCAAAAAAAAAAAAA
AAATATAAAAATATAGCTATGAATCTTCTATCCTATCAATATATCTATCTAAAAAATACA
TAAAATTTAATTAAATTCCACTCTTAGTTTAGTTATTGATTAAAAGAAATAAATTACAAT
CTATCAATATAGTTTAAGATACTCAAATAATTCTTCGAACATTCTTTTCACTCCTCAAAA
TCTTAAATTAATAAGCACATTATTCATACAAATTATCACCATATTTAAAATGAAGCCTCT
AGTAGCTCAAATTTTTAGGAAAGAATATGATTTCGCACCAAATTAAAAAAAACATATCTT
TCTTACTTTCTATGCATAAATAAGAGAAAGTAAAGAAATTTATTAATTATAGACATAGGT
TTAGAAAAAAAAAAATAATTAAGAAAGAAAGAAAAAGTAAGAAAGAAGAAGAAGAAGAAT
CTTTTACAGTGTTGTTAACACGTTTGACAAAGATTCGTTTAAATATTTATTTTTTTTTTT
TATATTTGAGAAAATAATTTAAATAAATTCTTAGAATCAAGAAAAAATAAATAAATAAAC
AAATAAATTTCTCTGTTTGTGATAATTAATTTAAAAATTTTTGAATTCGAACTCTAAAAA
AGGAGAATGTATCTATCTTGATTAAAGCTCTCTTAATTTATAAGCTGAAACGAAATAAAT
AAATAACTATAGTTGAGTCTTGTATATACAGATACACCAATAGGATTTCAATTTTTGATA
AATTTAATAAGAAATCAATAGCTAGAATGATAGATGGAAATTTTTGATCAAATATATTGA
TTAGCTTAACATGTTAATAAAATAAATAAAGGATAGAATATATGAATATAGAATAAATAG
TATTCCTTCCTCTTTTAGAGTGATGGTTAGTTGGTTGAGTTAATTTTGAGATATGAGTGT
TTATTTGTTTGTTTACTATTGAGATGATTTTAGAGAAATGAGCATTAAAATAATTTATAT
AAATTTAATAAAATAGGTGAACCCATCGATTAAAGAGGTCCCATTAAGGCTGCTAAGCTC
TATCCTATCCACAGAGATGCTCCCTCTTTCACTGATTAAGCTACTTCTGCTGAAATTTTG
GTTACTGGTATTAAGGTCGTCGATTTATTGGCTCCTTACGCTAGAGGTGGTAAGATTGGT
CTTTTCGGTGGTGCTGGTGTCGGTAAGACTGTGCTCATTCAAGAACTTATCAACAACGTT
GCTAAGCATCACGGTGGTTACTCCGTCTTCGCTGGTGTCGGTGAAAGAACCAGAGAAGGT
AACGATCTCTATCATGAAATGATGGACTCTAAGGTCATCAGTGTTAAGGAAGGTGAATCC
AGATGTGCCCTCATCTTCGGTTAAATGAACGAACCCCCAGGTGCCAGAGCTAGAGTCGGT
TTAACTGGTCTTACCGTCGCTGAATATTTCAGAGATGAAGAAGGTAAGGATGTCTTGCTT
TTCGTCGACAATATCTTCAGATTCACTCAAGCCTGTTCTGAAGTGTCTGCCTTGTTGGGT
CGTATTCCTTCTGCTGTCGGTTATCAACCTACCCTCGCTACCGATTTGGGTGCTTTATAA
GAAAGAATTACCACCACCCAAAAGGGTTCCATTACTTCCGTCCAAGCTATTTACGTACCT
GCTGATGATTTGACCGATCCCGCTCCCGCTACTACATTCGCTCACTTGGATGCTACTACT
GTGCTTAACAGAGGTTTGACCGAATTAGGTATCTATCCTGCCGTCGATCCTTTGGATTCT
ACCTCCAGAATGTTAGACCCCATCACCATTGGTGAAGAACATTACACTGTTGCAAGAGGT
GTCTAAAAGTTACTCCAAGATTACAAGTCACTTCAAGATATTATTGCCATTTTGGGTGTT
GATGATCTTTCTGAAGAAGATAAGCTCGTCGTCGCCAGAGCTAGAAAGGTCCAAAAGTTC
CTTTCTCAACCTTTCTTCATGTCTGAAGTTTTCTCTGGTATTCCCGGTAGATTCGTTAAC
CTTAAATAAAATATCGCTTCTTTCAAGGGTAAATAATTAACTTTATTTTTCATTTTTCAA
TCTATATTCAATCATTTATTTTAACTAATTCAAAAGCTCTCTTGGAAGGTGCTGGTGATG
AATATCCTGAAAGTTGTTTCTACATGAAGGGTGACCTCGAAGAATCTTTGGCTGCTGGTA
GAGCTGATGCCTTAAAGTCTAAGTGA