Identifiers and Description

Gene Model Identifier

TTHERM_00571860

Standard Name

ATP1 (ATP synthase 1)

Aliases

PreTt10516 | 76.m00218 | 3810.m02075

Description

ATP synthase F1, alpha subunit family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

  • proton-transporting two-sector ATPase complex, catalytic domain (IEA) | GO:0033178
  • proton-transporting two-sector ATPase complex (IEA) | GO:0016469

Molecular Function

  • hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances (IEA) | GO:0016820
  • proton-transporting ATPase activity, rotational mechanism (IEA) | GO:0046961
  • proton-transporting ATP synthase activity, rotational mechanism (IEA) | GO:0046933

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 19.4%

TetraMine Data

TTHERM_00571860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_59030
WormBaseWBGene000104199.997093137033517e-262ATP synthase subunit alpha, mi
tochondrial status:Confirmed
UniProt:Q9XXK1 protein_id
:CAA19429.1
Tetrahymena borealisEI9_03424.19.997093137033517e-262ATP synthase F1, alpha subunit
protein (547 aa)
DictyBaseDDB_G02940129.997093137033517e-262atp1 on chromosome: M position
15103 to 16662
OxytrichaContig20211.0.g809.997093137033517e-262ATP synthase alpha/beta family
, nucleotide-binding domain
SGDYBL099W9.997093137033517e-262ATP1 Alpha subunit of the F1 s
ector of mitochondrial F1F0 AT
P synthase, which is a large,
evolutionarily conserved enzym
e complex required for ATP syn
thesis; phosphorylated

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00571860(coding)
ATGATCAGAAACTTCCACAGTTTAGTCAAGAGAGTACCTAGACTCGCTCTTACTCCCTTC
TTCGGCTTCAGAACTTCCATGACTTTAGCCGATAAGAAGTTATCCACTGGTGAAGCCTCC
GTTGTCCTCGCCGAAAAGATTAAGGGAATCACTCAATAGAACGATATTACTGAATACGGT
ACAGTTATTTCAATTGGTGATGGTATTGCAAGAGTCTTTGGTTTGACTAAGGTCTAAGCA
GGTGAAATGGTTGAATTTAAGTCTGGTATTAGAGGTATGGCCCTTAACTTGGAAACTGAT
AACGTCGGTGTTGTCGTTTTGGGTAATGATAGAGATATTAAGGAAGGTGATGTCGTCAAG
AGAACTGGTGCCATCGTCGATGTCCCCATTGGTGAAGCTATGTGCGGAAGAGTCTTCGAT
GCCTTAGGTAACCCCATTGACGGTCTTGGTCCTCTTAAGACCACCCAAAGAGCCAGAGTT
GAAATCAAGGCTCCCGGTATTATTCCCAGACAATCCGTCAGACAACCTATGTAAACTGGT
ATTAAGTGTGTCGACTCCCTCGTCCCTATCGGTAGAGGTTAAAGAGAACTTATTATTGGT
GATAGATAAACTGGTAAGACTGCTATCGCTATCGATACCATCCTCAACCAAAAGGAAGCC
TTCAACACTGGTGATGTCAAGAAGTAATTATATTGCATTTACGTCGCCGTCGGTCAAAAG
AGATCTACCATTGCTAACTTGGTCTCCATCCTTAAGTAACACGATTGCATGAAGTTCACC
ATCGTCGTTTGCGCTACTGCTTCTGATGCTGCTCCCCTTTAATTCTTGGCTCCTTACTCT
GGTTGCGCCATCGGTGAATTCTTCAGAGATAACGGCAAGCACGCTTTAATTATCTACGAC
GATCTTTCCAAGCAAGCCGTCGCTTACAGACAAATGTCTTTGTTGTTGAGAAGACCTCCT
GGTAGAGAAGCTTATCCTGGTGATGTCTTCTATCTCCATTCTCGTCTTTTGGAAAGAGCC
GCTAAGATGAACGACAGCCTCGGTGGTGGTTCCTTGACTGCCTTGCCCGTCATTGAAACC
CAAGCTGGTGATGTCTCTGCTTATATTCCCACCAACGTTATTTCCATTACTGATGGTTAA
ATTTTCTTAGAAACTGAACTTTTCTACAAGGGTATCAGACCTGCCATTAACGTCGGTCTT
TCCGTCTCTAGAGTCGGTTCTGCCGCTTAAATTAAGGCCATGAAGAAGATTGCCGGTAAC
TTAAAGCTTACCCTCGCTACCTACAGAGAACTTGCTGCTTTCTCCCAATTCGGTTCTGAT
TTGGATGCCAAGACCCAATAATAATTGAACACTGGTGAAAGATTAGTTGAAATGTTAAAA
CAAAACTAATATACCCCCATGAAGGTCGAAGAATAAGTTTGTATTATTTTTGCTGGTGTC
AAGGGATTCTTAGATGCCCTCGTCACTTCTGAAGTCTTGAAGTTCGAAAAGAAGTTCCTT
GAACACGTCAGAACTAACCACTCTGCTCTCCTTAAAAGAATTAGAGACTCTGGTGATCTC
AGCGAAGTTGATACTAATGAACTCAACACTATTATTCCTCTCTTCATCCAAGAAGGTGGT
TTCAAGCTCAAGGCCTAATGA


>TTHERM_00571860(protein)
MIRNFHSLVKRVPRLALTPFFGFRTSMTLADKKLSTGEASVVLAEKIKGITQQNDITEYG
TVISIGDGIARVFGLTKVQAGEMVEFKSGIRGMALNLETDNVGVVVLGNDRDIKEGDVVK
RTGAIVDVPIGEAMCGRVFDALGNPIDGLGPLKTTQRARVEIKAPGIIPRQSVRQPMQTG
IKCVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKEAFNTGDVKKQLYCIYVAVGQK
RSTIANLVSILKQHDCMKFTIVVCATASDAAPLQFLAPYSGCAIGEFFRDNGKHALIIYD
DLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDSLGGGSLTALPVIET
QAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAAQIKAMKKIAGN
LKLTLATYRELAAFSQFGSDLDAKTQQQLNTGERLVEMLKQNQYTPMKVEEQVCIIFAGV
KGFLDALVTSEVLKFEKKFLEHVRTNHSALLKRIRDSGDLSEVDTNELNTIIPLFIQEGG
FKLKAQ


>TTHERM_00571860(gene)
ATGATCAGAAACTTCCACAGTTTAGTCAAGAGAGTACCTAGACTCGCTCTTACTCCCTTC
TTCGGCTTCAGAACTTCCATGACTTTAGCCGATAAGAAGTTATCCACTGGTGAAGCCTCC
GTTGTCCTCGCCGAAAAGATTAAGGGAATCACTCAATAGGTAAATATTCTTAAGAAAATA
ATTACATCTCTCATTGATTGAGTTAGGGGTTCTCAACTAAGTAATTATAAAAAACAAAGA
AAACCAAACCATATCTTTCAAAAAAGCAACAAAATTGAATTAAATCTAAATAGCCTAGAC
AACATAAAAAAAGAAGCATTAAAAAGTAAAACCATTAGAGGGATTAGACAAGATTTATAT
ATTCCATTGCTCATAAAAATAATAGTTTGCTTTGTTTTGGATATTTATTTGTATAGAGTT
ATTCCCAAATCAAACTAAGAAAAAACAAAGAGAAGATACCTTTTTTCCTTTCTTTTTATC
TTCTCTTTACCTATCAAGAAAGAAAGATATATAGGTGTCAATGAAATCGAATGCTAAACA
ACCCACATTTAGAGCAAAGTACTTAAATGGTGGCAATAATTTAGAGCAAGAAAAGAAAGC
CTTTCATAGTTTTATTTGCGATTAACTATATTATTTAGAAGCAAGCATATTTAAAAACCT
TAAATCAAATGATCGATCAATCGATTTTATTTATGATTACGCAGATCAATAAAAAAGATG
AGAGATTTTATAGAGAATGTGATAACGATGAAATTTACCTTTATTTTTTTTAACAATATA
AAGAACGATATTACTGAATACGGTACAGTTATTTCAATTGGTGATGGTATTGCAAGAGTC
TTTGGTTTGACTAAGGTCTAAGCAGGTGAAATGGTTGAATTTAAGTCTGGTATTAGAGGT
ATGGCCCTTAACTTGGAAACTGATAACGTCGGTGTTGTCGTTTTGGGTAATGATAGGTAA
AAAATTCATCCCTTTTTAAATAGCTAAAAAGCATCTGTCAAAAAGCTTTCAAGCAACATT
CATTTTTACTTCATTTCCAATCAACTACCGCATTTTCTCTCTTTTATGGGCTCTTTCAGT
ATCAATTGATTAAAATATCAATCAAATTACCTACTTTTTCGAAAGATACTTAAAAATACA
ATAAAAAAGTCAATAAAAATATGAAAAACAATATTTTATTCACAAATTCAAAAAAAGTAT
TTAAGTTTGAACCATGAGTTTCATTAAGGATAATTTAGATCATCATCAATAAATTTAGTA
AGCATCACTTGCTTCCAATAAATATGAAGCAAAGATTTAATTATGAAGAGCGTACGTTAT
TTGCCATAGTTATTTAAAATGATAAAGTTCATCAACATTAATAATTATTGAGAAAATAAG
TGAGTGAGTTGATTGAAAGTGTTCATTAATTGAAAATAAGTGGTCTTATTTTATTTAAAA
TATGATAGAGATATTAAGGAAGGTGATGTCGTCAAGAGAACTGGTGCCATCGTCGATGTC
CCCATTGGTGAAGCTATGTGCGGAAGAGTCTTCGATGCCTTAGGGTAAATTATTTAAACC
TACCGAAATATTTGATCATATTTTTAATGCTTCTCTTTTAAATTTTAATAGTAACCCCAT
TGACGGTCTTGGTCCTCTTAAGACCACCCAAAGAGCCAGAGTTGAAATCAAGGCTCCCGG
TATTATTCCCAGACAATCCGTCAGACAACCTATGTAAACTGGTATTAAGTGTGTCGACTC
CCTCGTCCCTATCGGTAGAGGTTAAAGAGAACTTATTATTGGTAATTACTTAATTGATTG
TTTATTTTACTTGCTTCTTATATGCTTGCTTACAATATCCTTAAATCCATTCATCACTAT
CCTTCCATCGCTCATCTTTTTAAATCGATAATCTTAAAATTAAGTCGATTTAAGAAAATA
TCATTTTACCAGAAAATAAAATTAAGAGGAATCAAAGAATGAAAATTAATAATTTAAAAA
CTAATCATAATATTGAGTGACAAACTAAGTACATAAACATAACAAAAAATAATTAGAAAG
TTGATAGATTAGCTTTTAAGATAAATACTCTTTGACTTTATATAAACAAAAAAAAAGAAT
ACAGATTTTATTAATTTGGATTGTTTTACCTTATTTATCCCTTAATAATTTATTTTCATT
TTACTTTTTAATAGAAAAAAGGGGAAATAAATAAATAAAAAAATTAATTAATATAAATAA
ATAAGCAAATAAAAATCAGAAAAGAAGGAAAAAAGATTCCCTTTTTTGGATTTTTAATTT
TAATTCTTTGATCCTTTTAAAAATCAATAATTTTTTATTTATTGATAAATCTTTTTTAAG
TTGGAAGATAAATTGATTGATTTTAATTATTACTTTGAATTCATTTTAGAGAACCTAATA
AAGAGCGTTTTACTCTTAAAATTTTGAAAATAAGCAAATTCTCTAGTTTAAAATCTGTAA
AATAACGTTGAGAATATTTATCTACTAATATATTTTTAATTCAACAAATTTAACTAAAAT
AAATTGCATATTTTATAAATTGATCAGACTATTCAATAGATATTTTAGCAAATAAAATAG
GTTTAATTAAAATTAGAATTGATCAATACAATTTTAAGTAGAAATTGCAAGCATTTTTTA
ATAACTAAATAAGTGATACTTTTGAATTTAAAATTAATTTATTTTTTAACTAAATTAGGT
GATAGATAAACTGGTAAGACTGCTATCGCTATCGATACCATCCTCAACCAAAAGGAAGCC
TTCAACACTGGTGATGTCAAGAAGTAATTATATTGCATTTACGTCGCCGTCGGTCAAAAG
AGATCTACCATTGCTAACTTGGTCTCCATCCTTAAGTAACACGATTGCATGAAGTTCACC
ATCGTCGTTTGCGCTACTGCTTCTGATGCTGCTCCCCTTTAATTCTTGGTAAAAATGAAT
TCAAAATTAATTTCCTTACTTTAAAAGCTTTAAAAAGAAATTATTTAATTATCACACTTT
TATAGTAATTGACTAAAAATTCAAATTGAAATTTAGATTAAATTAGATAAAATAATTTAA
TTAATTTTAAACAATTTTTACTAAATTATGAAATTTATTAAAAATTTTCTAATTAAAAAA
AGGCTCCTTACTCTGGTTGCGCCATCGGTGAATTCTTCAGAGATAACGGCAAGCACGCTT
TAATTATCTACGACGATCTTTCCAAGCAAGCCGTCGCTTACAGACAAATGTCTTTGTTGT
TGAGAAGACCTCCTGGTAGAGAAGCTTATCCTGGTGATGTCTTCTATCTCCATTCTCGTC
TTTTGGAAAGAGCCGCTAAGATGAACGACAGCCTCGGTGGTGGTTCCTTGACTGCCTTGC
CCGTCATTGAAACCCAAGCTGGTGATGTCTCTGCTTATATTCCCACCAACGTTATTTCCA
TTACTGATGGTTAAATTTTCTTAGAAACTGAACTTTTCTACAAGGGTATCAGACCTGCCA
TTAACGTCGGTCTTTCCGTCTCTAGAGTCGGTTCTGCCGCTTAAATTAAGGCCATGAAGA
AGATTGCCGGTAACTTAAAGCTTACCCTCGCTACCTACAGAGAACTTGCTGCTTTCTCCC
AATTCGGGTAAATAGATTTACAAATAAATTAACTGATCAATAACAAAAAATTAAAAAATA
CAAAAATAATTTTGACTTATTTTTAAATTTATAATATAAAAGTTCTGATTTGGATGCCAA
GACCCAATAATAATTGAACACTGGTGAAAGATTAGTTGAAATGTTAAAACAAAACTAATA
TACCCCCATGAAGGTCGAAGAATAAGTTTGTATTATTTTTGCTGGTGTCAAGGGATTCTT
AGATGCCCTCGTCACTTCTGAAGTCTTGAAGTTCGAAAAGAAGTTCCTTGAACACGTCAG
AACTAACCACTCTGCTCTCCTTAAAAGAATTAGAGAGTAAGATTTTATTTTGTTTTCTTC
AAGATATTTAAAAAAAGAGCACTCAATTTCATCTTCATGCATTTTGGGTTGTTTAAATAA
AAAAAAATATTTTAAATTGCTTTTTTTTTTGAAATATTTTTAAACTTAATTTATTAAATT
AATTAATTATAGCTCTGGTGATCTCAGCGAAGTTGATACTAATGAACTCAACACTATTAT
TCCTCTCTTCATCCAAGAAGGTGGTTTCAAGCTCAAGGCCTAATGA