Identifiers and Description

Gene Model Identifier

TTHERM_00037460

Standard Name

ATG82 (AuTophaGy related 8, ATG8)

Aliases

PreTt14481 | 2.m02082 | 3825.m02850

Description

ubiquitin-like protein whose conjugation target is phosphotidylethanolamine (PE); required for the formation of autophagosomes; Atg8p-PE is anchored to membranes; one two ATG8 genes in Tetrahymena, see TTHERM_00522490

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00037460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00999.12.0009803861620222e-78hypothetical protein (127 aa)
WormBaseWBGene000029804.001630327199692e-20locus:lgg-1 Protein lgg-1
status:Confirmed UniProt:Q09
490 protein_id:CCD66037.1
OxytrichaContig22034.0.g1034.998394530072393e-19Autophagy protein Atg8 ubiquit
in like
SGDYBL078C9.995317835403734e-19ATG8 Component of autophagosom
es and Cvt vesicles; undergoes
conjugation to phosphatidylet
hanolamine (PE); Atg8p-PE is a
nchored to membranes, is invol
ved in phagophore expansion, a
nd may mediate membrane fusion
during autophagosome formatio
n
DictyBaseDDB_G02861913.001003044337619e-17atg8 on chromosome: 4 position
4321108 to 4321704

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00037460(coding)
ATGGACGCTCAAAATTATAAACCCTTCAAGGAAAAATTCTCTCTAGCAGAAAGATAGAAA
GAATTAGAAAAGTAGAAATCTAAATACCCAAACATGATTCCCGTCATTGTTGAAATTAAC
AAGAAGGCAAAAACAGTTAGAGTATTGGAAAAGCAAAAGTTCTTGGTATCAAAGGATGTT
AAGCTTCACGAATTCCAATAAACAGTTCGTAAGAAATTAGATATTACAAATGAAGCTGAT
GCTTTGTTCTTCTTTGTTGGCAATAAAAAGATTGAGAAAATAAATAGAACAATGAGCGAA
ATTTACCAAGAATCAAAGGATAAGGATGATGGTTTCTTATATATCACATACTCTGATCAA
GAAGTATTTGGATCAATTTGA


>TTHERM_00037460(protein)
MDAQNYKPFKEKFSLAERQKELEKQKSKYPNMIPVIVEINKKAKTVRVLEKQKFLVSKDV
KLHEFQQTVRKKLDITNEADALFFFVGNKKIEKINRTMSEIYQESKDKDDGFLYITYSDQ
EVFGSI


>TTHERM_00037460(gene)
ATGGACGCTCAAAATTATAAACCCTTCAAGGAAAAATTCTCTCTAGCAGAAAGATAGAAA
GAATTAGAAAAGTAGAAATCTAAATACCCAAACATGATTCCCGTCATTGTTGAAATTAAC
AAGAAGGCAAAAACAGTTAGAGTATTGGAAAAGCAAAAGTAAACAAATTTAATAATGATT
TTAAAAACTTTGATTAATTTATTTCATTTACAAAAAGGTTCTTGGTATCAAAGGATGTTA
AGCTTCACGAATTCCAATAAACAGTTCGTAAGAAATTAGATATTACAAATGAAGCTGATG
CTTTGTTCTTCTTTGTTGGCAATAAAAAGATTGAGAAAATAAGTAAATATTATTTTTCCT
TTTTAATCAATTATTTAAGTTGAATGTAGAAATTCATTCAAAAACAATCTATCTAAATAA
AATGAATTCTAAAATTAAGCAATCAAAACTTTGAATTAATTTTCATTAATTTTAATCTTA
TAATTAATTAATAGATAGAACAATGAGCGAAATTTACCAAGAATCAAAGGATAAGGATGA
TGGTTTCTTATATATCACATACTCTGATCAAGAAGTATTTGGATCAATTTGA