Identifiers and Description

Gene Model Identifier

TTHERM_00522490

Standard Name

ATG8 (AuTophaGy related 8)

Aliases

PreTt12364 | 65.m00182 | 3717.m00061

Description

Ubiquitin-like protein whose conjugation target is phosphatidylethanolamine (PE); required for formation of autophagosomes; Atg8p-PE is anchored to membranes; one of two ATG8 genes in Tetrahymena (see TTHERM_00037460)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF04110 ) Autophagy protein Apg12
  • ( PF02991 ) Microtubule associated protein 1A/1B, light

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00522490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12857.13.9983507938127826e-75hypothetical protein (123 aa)
OxytrichaContig22034.0.g1033.998693556225637e-29Autophagy protein Atg8 ubiquit
in like
WormBaseWBGene000029808.000124778438792e-23locus:lgg-1 Protein lgg-1
status:Confirmed UniProt:Q09
490 protein_id:CCD66037.1
DictyBaseDDB_G02861913.0002687256732656e-20atg8 on chromosome: 4 position
4321108 to 4321704
SGDYBL078C1.9999391735788327e-19ATG8 Component of autophagosom
es and Cvt vesicles; undergoes
conjugation to phosphatidylet
hanolamine (PE); Atg8p-PE is a
nchored to membranes, is invol
ved in phagophore expansion, a
nd may mediate membrane fusion
during autophagosome formatio
n
Stentor CoeruleusSteCoe_194150.0000000000006914400106940203

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00522490(coding)
ATGGACTCAAATAAACGTTATAAAGATCTTCTTAGTGAAGATTAAAGAAAATCAGAATGC
GAAAATATAAGAAAGAATTATCCTGATAAGATTCCCCTCATTATTGAGAAGCATCCTAAA
TCTAAATTAGAATAAATAGATAGGACAAAATTCTTAATTCTTGAAAAGCTTAGAGTTTAT
CAAGTAAACACAATTATACGTAGAAAAATGAGTCTCAATAAAGTAGATGCTCTCTATCTC
TTTGTTAATGATAATATTCTTTTAAGAGGAGATTAATGCTTAAAAGATGTTTATGAAAAA
TACAAAGATTCAGATGGATTTATTTATCTTTCTTACTGCGAATATAGTTCTTTTGGTAAG
AATATCTGA


>TTHERM_00522490(protein)
MDSNKRYKDLLSEDQRKSECENIRKNYPDKIPLIIEKHPKSKLEQIDRTKFLILEKLRVY
QVNTIIRRKMSLNKVDALYLFVNDNILLRGDQCLKDVYEKYKDSDGFIYLSYCEYSSFGK
NI


>TTHERM_00522490(gene)
ATGGACTCAAATAAACGTTATAAAGATCTTCTTAGTGAAGATTAAAGAAAATCAGAATGC
GAAAATATAAGAAAGAATTATCCTGATAAGATTCCCCTCATTATTGAGAAGCATCCTAAA
TCTAAATTAGAATAAATAGATAGGACAAAGTAAAATATTTTTTAAGTTCCAATTCAATTA
TGCGGTTAGCTAAATTAAAATACATATTTAACAAAAATTTATTTGATGGAGTATTAATAG
CTCTATTTTATAATAATTGTATTAAAGTGCACATAATTTGAAGTTTCATTTTAGCAATTT
AGAAAATTATTTGGATATAAATTGGATTAATTTATTTTTTAACATTTTAAATAGATTCTT
AATTCTTGAAAAGCTTAGAGTTTATCAAGTAAACACAATTATACGTAGAAAAATGAGTCT
CAATAAAGTAGATGCTCTCTATCTCTTTGTTAATGATAATATTCTTTTAAGAGGAGGTAT
TTCATAAACTTAAATAATATAAATATAAGATTATTAGATTTTTTTAAAGAATCAAATTTA
TTAATGATTTTATTATATCCATAATTTCAATTTTTCTTAAATAAAATATGGTTTAAAGAT
AAATAATTTTAACAATAGATTAATGCTTAAAAGATGTTTATGAAAAATACAAAGATTCAG
ATGGATTTATTTATCTTTCTTACTGCGAATATAGTTCTTTTGGTAAGAATATCTGA