Identifiers and Description

Gene Model Identifier

TTHERM_00138370

Standard Name

ATG7 (Autophagy protein 7)

Aliases

PreTt24464 | 10.m00513 | 3698.m00230

Description

Autophagy protein 7

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

  • ( PF00899 ) ThiF family
  • ( TIGR02354 ) thiamine biosynthesis protein ThiF
  • ( TIGR02355 ) molybdopterin synthase sulfurylase MoeB
  • ( TIGR01381 ) E1-like protein-activating enzyme Gsa7p/Apg7p
  • ( TIGR02356 ) thiazole biosynthesis adenylyltransferase ThiF

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00138370

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05898.19.997093137033517e-262ThiF family protein (671 aa)
OxytrichaContig15667.0.g983.000678663157884e-145ThiF family
DictyBaseDDB_G02710962.9995941501461703e-129atg7 on chromosome: 2 position
20345 to 22738
WormBaseWBGene000108821.9991070409258158e-114locus:atg-7 status:Confirmed
UniProt:G5EBK4 protein_id
:CAA92753.1
SGDYHR171W1.0002646133906571e-103ATG7 Autophagy-related protein
and dual specificity member o
f the E1 family of ubiquitin-a
ctivating enzymes; mediates th
e conjugation of Atg12p with A
tg5p and Atg8p with phosphatid
ylethanolamine, required steps
in autophagosome formation
Stentor CoeruleusSteCoe_82575.814040485895939e-62

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22366125: Liu ML, Yao MC (2012) Role of ATG8 and autophagy in programmed nuclear degradation in Tetrahymena thermophila. Eukaryotic cell 11(4):494-506

Sequences

>TTHERM_00138370(coding)
ATGGACAAAAAATTTGAAATTATTCCATTTTCTCCTATGGCGGACATAGGATTTTGGAGT
ACATTAGCAAAGAAAAAGCTCGAAGAATGGAAATTAAATTCAGATCCTTAAGATATTTTT
GTTAAATTTAAGATTAGCAATTTCACAAGCAAAAAGGCATTTTTAAATCTAGATGTTTAC
AGCTTTCAACAATGGGAGCTACAGTTATAGGGACCTGTAGAAATTGTCATTTAAACTTAG
TTAAAAAATTACAATACAATTGAAGAGTTCAAATAAATAAACTACCATGACTTGTTTAAG
GACCTAACATAAAAGTAGATTTCTGCAATTGATAACTTTTTAAGTGGCAAAGACGAAAAT
TTAAATGCATTCATAATGAAATTAGTTACATTTGCAGATCTAAAAAAACATAATTATTCA
TACAAGCTATGTTCTCCCTCAATTAAAGTGGATGATTTTAATTTACTTGAAAAGAGCTCG
TTTAAAACTGCTTTTAACGATGAATAAAAACAAAAAGCATTTGATGAGTCTTTGAAGCAA
TTTTTAAAAAGCGGAAAGATTTCACCTTTCTTCTACTGTAAAGAAGTTGACGGGGGAAAA
TTTGTTTTTGGTACATTAAGAGAATATCTTAGCGAATTAGAAACAGGAAAAACAAATGAT
TTATATGGAGTATTTTTTGATCCATATAACTAAAATACAGGAACACACGCATACTTCACC
AATTTACTTGCATTAGTACTTAAGTTAGCAGAATAAAAAGGGATTAAAAATATTCTATCA
AACCTAAAATTTATCTTGCTTAAAGATTCCCTCATATACAATTTTGCTAATAAATATGAT
ATGAAAAATTCTTTGGTTGTGTCTGTTGACTTGACTAATGCTAAAATTGATGCTGAATCA
TACACAGGCTGCGACCCAAACTAAATACCCCCAAGTATAGACTTAAAAAGCTCTCTAGAT
GAAGCTACCTTAGCCACAGATGCTGTAGATTTAAATATTAAGCTAATGAAATGGAGGGTC
TTGCCTACCCTTGATCTCGAACTGTTGAAGAGCACAAAGGTATTGATGTTAGGTGCAGGT
ACTTTAGGATGCTAGTTAAGTCGTAATTTGATCGGTTGGGGTATTAAGCATATCACTTTT
GTTGACTATGGCAAGATATCTTATTCTAACCCTGTGCGTTAATCTCTTTATGAATTTGAA
GATACTATCAATGGAGGTAAGCCTAAGGCTGAGACCGCTGCTGAGAAATTAAAAAAAATA
TTTCCAGATATTGTTAGCAAGGGCTATTAAATTAAGATTCCAATGCCTGGCCACTATCTA
GCAAGTGTTGAGCATGCTATTGAAACACTAAAAGACGTAGATCTTCTAGAAGAACTTGTT
AAAGAGCATGATGTTCTTTACTTAATGACTGACTCTCGTGAATCTCGTTGGCTACCTACC
ATATTAGCAAACAAATACAATAAGATTTGTATTACTGTTGGCCTTGGATTTGACTCTTTT
GTTATTGTTCGTCATGGTCTATCACCTAAAGTGCATAACCCCGAAATAAATGGTGAAAGA
TTGAGTTGCTATTTCTGCAACGATGTTATTTCTCCTGGAAATACTATGAAGGATAGAACT
CTTGATTAACAATGCACAGTTACTCGTCCTGGTTTATCTTTTGTAAGCTCAGCCTATGCA
AGTGAATTATTGATTTCTTTACTGCACCACCCACTGAAAAATGGAGCTCCTGCAGCTGAT
GAAATCGAAAAACTACCTCAAACTGATCTAGGTATTCTTCCCTAGCATATCAGAGGAACT
ATGGGTGAATTTGAGACAAGAGTGATGTATGGCAGAGCATTTGAACACTGTGTAGCCTGC
AGTGAATTTGTTTTAGATGAATATCTAAAAGACCGTGACAATTTCTTATAGAGAGTTATT
AATGATCCTGATTATTTGCAGTAAGTAACTAAATTGTCTGAGCTTCTTAGGGATTTAGAT
GGTACTGATGCTTTTATAGAAGTAGATGATTGA


>TTHERM_00138370(protein)
MDKKFEIIPFSPMADIGFWSTLAKKKLEEWKLNSDPQDIFVKFKISNFTSKKAFLNLDVY
SFQQWELQLQGPVEIVIQTQLKNYNTIEEFKQINYHDLFKDLTQKQISAIDNFLSGKDEN
LNAFIMKLVTFADLKKHNYSYKLCSPSIKVDDFNLLEKSSFKTAFNDEQKQKAFDESLKQ
FLKSGKISPFFYCKEVDGGKFVFGTLREYLSELETGKTNDLYGVFFDPYNQNTGTHAYFT
NLLALVLKLAEQKGIKNILSNLKFILLKDSLIYNFANKYDMKNSLVVSVDLTNAKIDAES
YTGCDPNQIPPSIDLKSSLDEATLATDAVDLNIKLMKWRVLPTLDLELLKSTKVLMLGAG
TLGCQLSRNLIGWGIKHITFVDYGKISYSNPVRQSLYEFEDTINGGKPKAETAAEKLKKI
FPDIVSKGYQIKIPMPGHYLASVEHAIETLKDVDLLEELVKEHDVLYLMTDSRESRWLPT
ILANKYNKICITVGLGFDSFVIVRHGLSPKVHNPEINGERLSCYFCNDVISPGNTMKDRT
LDQQCTVTRPGLSFVSSAYASELLISLLHHPLKNGAPAADEIEKLPQTDLGILPQHIRGT
MGEFETRVMYGRAFEHCVACSEFVLDEYLKDRDNFLQRVINDPDYLQQVTKLSELLRDLD
GTDAFIEVDD


>TTHERM_00138370(gene)
ATGGACAAAAAATTTGAAATTATTCCATTTTCTCCTATGGCGGACATAGGATTTTGGAGT
ACATTAGCAAAGGTAAAATGAGAAATGTAATCAATTCACTCACACGTTTCTTATTATATA
GAAAAAGCTCGAAGAATGGAAATTAAATTCAGATCCTTAAGATATTTTTGTTAAATTTAA
GATTAGCAATTTCACAAGCAAAAAGGCATTTTTAAATCTAGATGTTTACAGCTTTCAACA
ATGGGAGCTACAGTTATAGGGACCTGTAGAAATTGTCATTTAAACTTAGTTAAAAAATTA
CAATACAATTGAAGAGTTCAAATAAATAAACTACCATGACTTGTTTAGTAAGAATTAATC
TTGTTTTTCAAAATAATTAAAAATGCATTTAATGATTTTTCAATTTAAAATATTTTGTTT
TAGAATAAACTTTAAACAAAGCTTTTTAAGTGAGTATAAATAAATTAATAAATATTTTAT
ATTTAAAGAGGACCTAACATAAAAGTAGATTTCTGCAATTGATAACTTTTTAAGTGGCAA
AGACGAAAATTTAAATGCATTCATAATGAAATTAGTTACATTTGCAGATCTAAAAAAACA
TAATTATTCATACAAGCTATGTTCTCCCTCAATTAAAGTGGATGATTTTAATTTACTTGA
AAAGAGCTCGTTTAAAACTGCTTTTAACGATGAATAAAAAGTATTACTTTTCTTTTTTTT
GTTAAGTATATACATATGTATTTAATACAAAATGTTAATAAAATGCTCACTAATTAATAT
TTGAACATTTAAAGCAAAAAGCATTTGATGAGTCTTTGAAGCAATTTTTAAAAAGCGGAA
AGATTTCACCTTTCTTCTACTGTAAAGAAGTTGACGGGGGAAAATTTGTTTTTGGTACAT
TAAGAGAATATCTTAGCGAATTAGAAACAGGAAAAACAAATGATTTATATGGAGTATTTT
TTGATCCATATAACTAAAATACAGGAACACACGCATACTTCACCAATTTACTTGCATTAG
TACTTAAGTTAGCAGAATAAAAAGGGATTAAAAATATTCTATCAAACCTAAAATTTATCT
TGCTTAAAGATTCCCTCATATACAATTTTGCTAATAAATATGATATGAAAAATTCTTTGG
TTGTGTCTGTTGACTTGACTAATGCTAAAATTGATGCTGAATCATACACAGGCTGCGACC
CAAACTAAATACCCCCAAGTATAGACTTAAAAAGCTCTCTAGATGAAGCTACCTTAGCCA
CAGATGCTGTAGATTTAAATATTAAGCTAATGAAATGGAGGGTCTTGCCTACCCTTGATC
TCGAACTGTTGAAGAGCACAAAGGTATCACTTATGAAATAAAATACTATTTACTGATGAA
TTAAAAATGGAGTTTAATGAATCAAAATGTTTAAAGAAATTTATTAATTTATTAAAAATA
GTCAATAACTTAATTTTTGTATATTCCCTAAGAAAAATGGCTTGATTTAAAATATATTTC
AATGACTTTACCATATTTTTGAAGGCTAATTTTTTTATTTATTTACAAAAGGTATTGATG
TTAGGTGCAGGTACTTTAGGATGCTAGTTAAGTCGTAATTTGATCGGTTGGGGTATTAAG
CATATCACTTTTGTTGACTATGGCAAGATATCTTATTCTAACCCTGTGCGTTAATCTCTT
TATGAATTTGAAGATACTATCAATGGAGGTAAGCCTAAGGTAAAAATTTAAAAAACCCTT
CTCTTTATTCTAGAAAATGTTATAGACAGTTTGAAAAGATAGGATGATAGTATTAGAATT
ATTTGAGCTAATACAAACTGTTGAATAGTAAGTAAAAAGAGAGGAGGAAAATCTTGAAGC
AAGTTTTCAAAAGTTCCCCAACCAAAAAAAGGAAAACTTTTATATCAATTCAACTTTCTT
CCTTTTCTGAATTACCTACAATAATTTTGTTTGTCTGTTTATCACACAGTTCTAAATAAT
TAACAAATCATGATTTTAAAATTGTATAATAATAGGCTGAGACCGCTGCTGAGAAATTAA
AAAAAATATTTCCAGATATTGTTAGCAAGGGCTATTAAATTAAGATTCCAATGCCTGGCC
ACTATCTAGCAAGTGTTGAGCATGTAAAAAATTTCTCTCATCACATCAATTCAAATTTTT
TCAAATTGATTTTATTGCAATTTGCATTAAAAAATTATCCACTAAATTAAATACGTTCAA
TTATTTAAGCTATTTTAATTTTTTTTTTTTATAGGCTATTGAAACACTAAAAGACGTAGA
TCTTCTAGAAGAACTTGTTAAAGAGCATGATGTTCTTTACTTAATGACTGACTCTCGTGA
ATCTCGTTGGCTACCTACCATATTAGCAAACAAATACAATAAGGTAATCTTTCCTAGAAA
TATAAATATTTATTCCATGTTTAATAAACTCCTCCCCATTTTACAATGAAATTAAGCAGG
AGAAAAGACAAACAATAAAAATAATTGATTTCATTTAGTGTTTCAGAGCTTGAATCTCTC
TCTGCATATTCAAATTAATTTACTTTAATTTTATCACTTTTAAATTTTGAAATATCAATA
GATTTGTATTACTGTTGGCCTTGGATTTGACTCTTTTGTTATTGTTCGTCATGGTCTATC
ACCTAAAGTGCATAACCCCGGTAAATTTAATTTAAAAAATGTGTATCTCCATTGATAGTT
TTTTTATTTTGAAATCAGTTCAAGTTAGTTTTTTTCATCTCTTTTTGAAATGATTTTATA
GATTTTTGTTTATTTTTATTAAATTAAAATAATTTTATTAAAATGTTTGATTAAAAAATT
AGAAATAAATGGTGAAAGATTGAGTTGCTATTTCTGCAACGATGTTATTTCTCCTGGAAA
TACTATGAAGGATAGAACTCTTGATTAACAATGCACAGTTACTCGTCCTGGTTTATCTTT
TGTAAGCTCAGCCTATGCAAGTGAATTATTGATTTCTTTACTGCACCACCCACTGAAAAA
TGGAGCTCCTGCAGCTGATGAAATCGAAAAACTACCTCAAACTGATCTAGGTAAATTAAA
ATAGTTTTGATTTTATAGGTTAAAGGCTATATTGATGAGTGATAGATAATACAATCTATT
ATATAATGCTTTCATGAAAACAAATAATTTTTCATACTTCATTAAAAAGGATGAAGATAA
AGTATTAACGTAGTAAAAGAATTTGAAATAGCTATTCAACCATTTAATGAAATTTACAAT
CTAATCTGACATATATTAATTAAAATTTTGTGTCTACAAATGTAATAAGGTATTCTTCCC
TAGCATATCAGAGGAACTATGGGTGAATTTGAGACAAGAGTGATGTATGGCAGAGCATTT
GAACAGTAAAAAACTTGTTTATATTTTATCATATAGAGATTTATTTTCATATATTTATTG
AGAGAGAAGGGTGGGGAAATTAATTTTATAGTATTAGATATATTTCATATTATTTATGAT
TTATTGATAGATTGCTTTAATGAATGAATTTATTTATTTATTTACTTATTTTTATCGTTG
CATATAAAAAGCTGTGTAGCCTGCAGTGAATTTGTTTTAGATGAATATCTAAAAGACCGT
GACAATTTCTTATAGAGAGTTATTAATGATCCTGATTATTTGCAGGTGAGTTTTTTATTT
TCTTTAAAAAATTTAATTTAAAAAAGGGGTTGGCATTTATTTTAATCTAGAATAGATCAC
AATCATCCTCATATTAAATTTACATATAATAAACCAATGTTTTAAAAATTCTAATTTTTA
AACATATTTAAAATAGTAAGTAACTAAATTGTCTGAGCTTCTTAGGGATTTAGATGGTAC
TGATGCTTTTATAGAAGTAGATGATTGA