Identifiers and Description

Gene Model Identifier

TTHERM_00455640

Standard Name

ATG6 (AuTophaGy 6)

Aliases

PreTt20293 | 53.m00195 | 3712.m00056

Description

Autophagy protein; involved in programmed nuclear degradation (autophagy)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

  • ( PF04111 ) Autophagy protein Apg6
  • ( PF07671 ) Protein of unknown function (DUF1601)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00455640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13756.11.999126889527329e-167hypothetical protein (737 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22366125: Liu ML, Yao MC (2012) Role of ATG8 and autophagy in programmed nuclear degradation in Tetrahymena thermophila. Eukaryotic cell 11(4):494-506

Sequences

>TTHERM_00455640(coding)
ATGGATAACAAAAAGAAGAAATAAAAGTAAAATAATATAAATTGTGGATTTTATTCTGAA
ACCTTCAGCATATAAATCTCACATTCATAAGAATAAGTCAAGGAAGCTGTGCTTATTGAG
GGAAACCTTGTTAGTGGCCCTTCTATTTTTATTGTTTTCTTTGATAAAAAATTCTACCAT
ATATCGCTTAAGTCGAAATAAATTTTAAGTATTGGAGAAATTGTTGCTGAAAACTCATTT
TAAAACTTTAAGTCAGTTATATTAAATAATAAGTAATACATAGGTTTTACTACTCAATAT
GAACTTCATCTTTTAGATTTAGAATCAAAATAGCTTTTATAAAATAATTTTCGTATTAAA
ATTCCTGGAAGTAATAATGAACTAAATGATGAACAAAAGTAAAGCTTGATGCAGGATGGA
TTTATGTATGAAGCATTCAATAAATTAAATATTATAGCCACTTGTGAAGTAATGGGAGTA
ACAAATTTACCCTCTGATGATAAAAATGTATTTTATTGTTGCATATACAATTTTTATGAG
AATGAAAAAACATATATGTTTCATATGGAAACAAAAAGTAAATAAGTTTTGTTTTGTAAA
TTAAACGATTCGGATACATTTGCAGTTTTTGAAAATCACAGATAATTTTCGAAATAAGAA
AATGTTGAATTAGTTTTACACACTTATAATGTATCAAAAAGCAAGATATATGGTTATAAG
AAGATTAAGCTACCTATTAAAGAGGATAGTTGTATACTTTCTGCAAGATATATTGATAAA
GAATATAGTTAAATAATAATTATTGGCAATGGTAAATGTGCTCCTTTCCTAAAGGTCTTC
TCCCTCTCACAAGATTAGGAGCCAAAAGTGCAGTTATTAACTGATCTGATTCTGAATAGA
TCCTTTGATCAGCTTATAAGTAAAGTTTTGCTAATAAACGAAAAATACATTTTTTACGAA
ACAGTATAAGAAGGAGGAGTGTATTTTGAATTTTTAGAGTATAACACAAGAAAGATTAAA
TATAGAAAGTAAATTCAATATTAAAAAAATAAATACTTAGAAGACAAAGAAAAATAAATG
ACAAAAGATGAATTTAGCTAAATGTAAAAATATCCAAACGATTAAGTTTATATTTAGAAT
GTTCAGTGTTATAGTGAAAATATTTTGGTACTTTTGGATGATTAAGATTTTGAAAATTAT
TATGGATAATTGCCATATCAGCTTTTAATAAATTATCATAAGTATTGTTCATTATAAACT
CTTTTGTTATATCTGATGAAAAAAAAGGATTTAATTTTAGATTATAGTGAATACGATATA
AAAAATTGCATAGATATGCTTTTAAAAGATGATAATTAGTGA


>TTHERM_00455640(protein)
MDNKKKKQKQNNINCGFYSETFSIQISHSQEQVKEAVLIEGNLVSGPSIFIVFFDKKFYH
ISLKSKQILSIGEIVAENSFQNFKSVILNNKQYIGFTTQYELHLLDLESKQLLQNNFRIK
IPGSNNELNDEQKQSLMQDGFMYEAFNKLNIIATCEVMGVTNLPSDDKNVFYCCIYNFYE
NEKTYMFHMETKSKQVLFCKLNDSDTFAVFENHRQFSKQENVELVLHTYNVSKSKIYGYK
KIKLPIKEDSCILSARYIDKEYSQIIIIGNGKCAPFLKVFSLSQDQEPKVQLLTDLILNR
SFDQLISKVLLINEKYIFYETVQEGGVYFEFLEYNTRKIKYRKQIQYQKNKYLEDKEKQM
TKDEFSQMQKYPNDQVYIQNVQCYSENILVLLDDQDFENYYGQLPYQLLINYHKYCSLQT
LLLYLMKKKDLILDYSEYDIKNCIDMLLKDDNQ


>TTHERM_00455640(gene)
ATGGATAACAAAAAGAAGAAATAAAAGTAAAATAATATAAATTGTGGATTTTATTCTGAA
ACCTTCAGCATATAAATCTCACATTCATAAGAATAAGTCAAGGAAGCTGTGCTTATTGAG
GGAAACCTTGTTAGTGGCCCTTCTATTTTTATTGTTTTCTTTGATAAAAAATTCTACCAT
ATATCGCTTAAGTCGAAATAAATTTTAAGTATTGGAGAAATTGTTGCTGAAAACTCATTT
TAAAACTTTAAGTCAGTTATATTAAATAATAAGTAATACATAGGTTTTACTACTCAATAT
GAACTTCATCTTTTAGATTTAGAATCAAAATAGCTTTTATAAAATAATTTTCGTATTAAA
ATTCCTGGAAGTAATAATGAACTAAATGATGAACAAAAGTAAAGCTTGATGCAGGATGGA
TTTATGTATGAAGCATTCAATAAATTAAATATTATAGCCACTTGTGAAGTAATGGGAGTA
ACAAATTTACCCTCTGATGATAAAAATGTATTTTATTGTTGCATATACAATTTTTATGAG
AATGAAAAAACATATATGTTTCATATGGAAACAAAAAGTAAATAAGTTTTGTTTTGTAAA
TTAAACGATTCGGATACATTTGCAGTTTTTGAAAATCACAGATAATTTTCGAAATAAGAA
AATGTTGAATTAGTTTTACACACTTATAATGTATCAAAAAGCAAGATATATGTAAAATAT
TTTATTTTTTATTAAAATAATTAATAAAATAATGTTTTTTTAGGGTTATAAGAAGATTAA
GCTACCTATTAAAGAGGATAGTTGTATACTTTCTGCAAGATATATTGATAAAGAATATAG
TTAAATAATAATTATTGGCAATGGTAAATGTGCTCCTTTCCTAAAGGTCTTCTCCCTCTC
ACAAGATTAGGAGCCAAAAGTGCAGTTATTAACTGATCTGATTCTGAATAGATCCTTTGA
TCAGCTTATAAGTAAAGTTTTGCTAATAAACGAAAAATACATTTTTTACGAAACAGTATA
AGAAGGAGGAGTGTATTTTGAATTTTTAGAGTATAACACAAGAAAGATTAAATATAGAAA
GTAAATTCAATATTAAAAAAATAAATACTTAGAAGACAAAGAAAAATAAATGACAAAAGA
TGAATTTAGCTAAATGTAAAAATATCCAAACGATTAAGTTTATATTTAGAATGTTCAGTG
TTATAGTGAAAATATTTTGGTACTTTTGGATGATTAAGATTTTGAAAATTATTATGGATA
ATTGCCATATCAGCTTTTAATAAATTATCATAAGTATTGTTCATTATAAACTCTTTTGTT
ATATCTGATGAAAAAAAAGGATTTAATTTTAGATTATAGTGAATACGATATAAAAAATTG
CATAGATATGCTTTTAAAAGATGATAATTAGTGA