Identifiers and Description

Gene Model Identifier

TTHERM_00494030

Standard Name

ATG5 (Autophagy protein 5)

Aliases

PreTt04240 | 61.m00227 | 3711.m00074

Description

Autophagy protein 5

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

  • ( PF04106 ) Autophagy protein Apg5

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00494030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13000.19.001310321615282e-163hypothetical protein (320 aa)
OxytrichaContig14975.0.g342.0004286606204839e-16Autophagy protein Apg5
SGDYPL149W0.000000009996807949091551ATG5 Conserved protein involve
d in autophagy and the Cvt pat
hway; undergoes conjugation wi
th Atg12p to form a complex in
volved in Atg8p lipidation; co
njugated Atg12p also forms a c
omplex with Atg16p that is ess
ential for autophagosome forma
tion
WormBaseWBGene000221520.0000007997233352734267locus:atg-5 status:Confirmed
protein_id:CDM63580.1
DictyBaseDDB_G02898810.0000020007268868677913atg5 on chromosome: 5 position
3433996 to 3435424

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22366125: Liu ML, Yao MC (2012) Role of ATG8 and autophagy in programmed nuclear degradation in Tetrahymena thermophila. Eukaryotic cell 11(4):494-506

Sequences

>TTHERM_00494030(coding)
ATGGCAGAGGAACAAAAATAAACAGATTTTGAAAGAGATTAAAAAGAAATTAGGTCTTTA
ATATGGCAAAATAAAATCCCTGTTAAAATTAAATTAGACCCAGAACAAAATAGCAATAAT
GAGGAACCATTTCCTCTTTATATGTTCTTTTAAAGAGTTCACCTACCAGTATTTTATTAT
GAATAAATTCATGAGTACTTTGAAAAATTTGCTCCTGTTCCAAGAAATTAGGATGATATA
TGGTTAGAATGGAATAATAAACCAATTGCTTGGAATTTACCCTTTGGAGTGACTTTTGAT
TTAAATTATTAGGACCCATCTATGAAAGGAGAATTAGGTGATGATGATAGTTTTGATTTA
GGAATTTAAGAAATTCCTCCACCATTTATTCCTTAAAATATAATCTTGCATTATGGTCCT
TGCACTATTTCTAATGACTATACTCCTATTCCAAGCATCCCTGGCAAAACCGTATTAGAT
ATAGCAAAAAAAAGTTTTAGGTTTGCCCTTAAAGAATCACTTCATATTAGATTTGATAGC
GATACTATTCTTATGTAAATGGAAGCAGAAAAATAAAACGAATTATGGGAATCTTATAAA
AACCTCAACCAAAACACCTTTTTTAGCATTTTAGATTAGATATTTTAGTTGAAAAATCAT
TTGTAAAATAACAAAGCAATTAAATTGCCTGTAAGAGTGTATATAGAAGGTTATATAGGT
CGTATATAACTCTCTCATCAAATAGATTCTGAAAATGATACTTTAGGCGATTTTCTAACA
AAATATTTCCCTAAAATTTTAAAATAAACAGATACTGCCTTTGAAATAATTAATGATAAT
TACAAAAACTTCAAAGTAATATGCAATGGAATTGTTTGTAACTTAAACATGCCTTTACTT
TACTTTTACAAATATTTCTCTCATTATGATGGCTTCACTTATCTATGTATATAAAAATGA


>TTHERM_00494030(protein)
MAEEQKQTDFERDQKEIRSLIWQNKIPVKIKLDPEQNSNNEEPFPLYMFFQRVHLPVFYY
EQIHEYFEKFAPVPRNQDDIWLEWNNKPIAWNLPFGVTFDLNYQDPSMKGELGDDDSFDL
GIQEIPPPFIPQNIILHYGPCTISNDYTPIPSIPGKTVLDIAKKSFRFALKESLHIRFDS
DTILMQMEAEKQNELWESYKNLNQNTFFSILDQIFQLKNHLQNNKAIKLPVRVYIEGYIG
RIQLSHQIDSENDTLGDFLTKYFPKILKQTDTAFEIINDNYKNFKVICNGIVCNLNMPLL
YFYKYFSHYDGFTYLCIQK


>TTHERM_00494030(gene)
ATGGCAGAGGAACAAAAATAAACAGATTTTGAAAGAGATTAAAAAGAAATTAGGTCTTTA
ATATGGCAAAATAAAATCCCTGTTAAAATTAAATTAGACCCAGAACAAAATAGCAATAAT
GAGGAACCATTTCCTCTTTATATGTTCTTTTAAAGAGTTCACCTACCAGTATTTTATTAT
GAATAAATTCATGAGTACTTTGAAAAATTTGCTCCTGTTCCAAGAAATTAGGATGATATA
TGGTTAGAATGGAATAATAAACCAATTGCTTGGAATTTACCCTTTGGAGTGACTTTTGAT
TTAAATTATTAGGACCCATCTATGAAAGGAGAATTAGGTGATGATGATAGTTTTGATTTA
GGAATTTAAGAAATTCCTCCACCATTTATTCCTTAAAATATAATCTTGCATTATGGTCCT
TGCACTATTTCTAATGACTATACTCCTATTCCAAGCATCCCTGGCAAAACCGTATTAGAT
ATAGCAAAAAAAAGTTTTAGGTTTGCCCTTAAAGAATCACTTCATATTAGATTTGATAGC
GATACTATTCTTATGTAAATGGAAGCAGAAAAATAAAACGAATTATGGGAATCTTATAAA
AACCTCAACCAAAACACCTTTTTTAGCATTTTAGATTAGATATTTTAGTTGAAAAATCAT
TTGTAAAATAACAAAGCAATTAAATTGCCTGTAAGAGTGTATATAGAAGGTTATATAGGT
CGTATATAACTCTCTCATCAAATAGATTCTGAAAATGATACTTTAGGCGATTTTCTAACA
AAATATTTCCCTAAAATTTTAAAATAAACAGATACTGCCTTTGAAATAATTAATGATAAT
TACAAAAACTTCAAAGTAATATGCAATGGAATTGTTTGTAACTTAAACATGCCTTTACTT
TACTTTTACAAATATTTCTCTCATTATGATGGCTTCACTTATCTATGTATATAAAAATGA