Identifiers and Description

Gene Model Identifier

TTHERM_01050620

Standard Name

ATG3 (AuTophaGy 3)

Aliases

PreTt27805 | 212.m00063

Description

Autophagocytosis associated protein, C-terminal domain containing protein; involved in programmed nuclear degradation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

  • ( PF03986 ) Autophagocytosis associated protein, N-terminal domain
  • ( PF03987 ) Autophagocytosis associated protein, C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_01050620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01458.19.997093137033517e-262autophagocytosis associated pr
otein domain-containing protei
n (282 aa)
OxytrichaContig10290.0.g211.0001801308941382e-55Autophagocytosis associated pr
otein (Atg3), N-terminal domai
n
WormBaseWBGene000219227.001220308967917e-48locus:atg-3 Autophagy-relate
d protein 3 status:Confirmed
UniProt:Q9N369 protein_id
:CCD74062.1
SGDYNR007C1.9998323414791308e-36ATG3 E2-like enzyme involved i
n autophagy and the cytoplasm-
to-vacuole targeting (Cvt) pat
hway; plays a role in formatio
n of Atg8p-phosphatidylethanol
amine conjugates, which are in
volved in membrane dynamics du
ring autophagy and Cvt
DictyBaseDDB_G02773192.000470901975128e-28atg3 on chromosome: 2 position
7690557 to 7691968
Stentor CoeruleusSteCoe_172706.47023492564546e-26

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22366125: Liu ML, Yao MC (2012) Role of ATG8 and autophagy in programmed nuclear degradation in Tetrahymena thermophila. Eukaryotic cell 11(4):494-506

Sequences

>TTHERM_01050620(coding)
ATGAACGTGTATGACAATATAAAGAATAAATTGAATAATGTCAAGAATGATATAATATCT
GTTGTTTATGCTCCTCCCACAGAGTCTAGATTTTTCGAAGAAGGTAAATTGACTCCTTAG
GAATTTGTAACAAGTGGTGATGCATTGATCAACATGTGTCCTTAATGGAAATGGATGCCC
GCAAGCGCTGAAAAGTATAAAAATAAATATCTTCCTGCTGAGAAGCAGTATCTTCTCATG
GAAAAAGTTCCTTGTGATCAAAGAGTTTAAGAATTAATGGATAGCATTGCAGTTAATGAG
AAAGAAGATGAAGAAGAATATATCATTAATGACCAAAAGAAGAACAACGATTAGAATATA
ATTGAAACCAAAATTGGACAACTTAGCATCAAAGAACATTTCACCGAAGAAAAATAAGGT
GGTGAAGAAAAGAAAGAAGATAATGACGATGATAATGTTGTTGTAGTAGAAGCTCCTATT
GAAAGAAGATATTACGATTTGTCAATTTGCTATGATTTGGTAACATACACTCCTCACTTA
TTTTTGCAAGGAGTTGATGAAGATAATGTGCCACTTAAGTAAAACCAAGTATTTGAAGAC
ATTGTCAGTCATTACTCCAATAAAACAATCACATTTGAAGTCATGCCTTAAACAGGTATT
GTCCAAGCATCTCTCCATCCTTGCAAACACTCTCAAGTCATTAAACACATGGTTGATAAT
ATAAATTAATCAGGTGGCTCAATTAAAAGCCACTAGTGCTTATTCGTTTTCTTGAAATTC
TTATAATCTGTGATTCCCACTATTGAATACGATGTAGCAGGAGACATCATCTTTGACGAG
TGA


>TTHERM_01050620(protein)
MNVYDNIKNKLNNVKNDIISVVYAPPTESRFFEEGKLTPQEFVTSGDALINMCPQWKWMP
ASAEKYKNKYLPAEKQYLLMEKVPCDQRVQELMDSIAVNEKEDEEEYIINDQKKNNDQNI
IETKIGQLSIKEHFTEEKQGGEEKKEDNDDDNVVVVEAPIERRYYDLSICYDLVTYTPHL
FLQGVDEDNVPLKQNQVFEDIVSHYSNKTITFEVMPQTGIVQASLHPCKHSQVIKHMVDN
INQSGGSIKSHQCLFVFLKFLQSVIPTIEYDVAGDIIFDE


>TTHERM_01050620(gene)
ATGAACGTGTATGACAATATAAAGAATAAATTGAATAATGTCAAGAATGATATAATATCT
GTTGTTTATGCTCCTCCCACAGAGTCTAGATTTTTCGAAGAAGGTAAATTGACTCCTTAG
GAATTTGTAACAAGTGGTGATGCATTGATCAACATGTGTCCTTAATGGAAATGGATGCCC
GCAAGCGCTGAAAAGTATAAAAATAAATATCTTCCTGCTGAGAAGCAGTATCTTCTCATG
GAAAAAGTTCCTTGTGATCAAAGAGTTTAAGAATTAATGGATAGCATTGCAGTTAATGAG
AAAGAAGTAAGTATTTCAAAAAAGAGAATTTTAATAATGTTTAGAAATAGAAAATAATCA
ATTTATTTATGCATTTTGAGATTGTCATTTCTTAAAGACATTTATTAGCAAATAGCTAGC
TCTTATTAAAGCTTAAAATAATTTTATTAGGATGAAGAAGAATATATCATTAATGACCAA
AAGAAGAACAACGATTAGAATATAATTGAAACCAAAATTGGACAACTTAGCATCAAAGAA
CATTTCACCGAAGAAAAATAAGGTGGTGAAGAAAAGAAAGAAGATAATGACGATGGTATT
ATATTTATTTTTTACTAATAAGTAGACTAATTAATATCAGCCATATTAAATTGCATTCAT
TTAAAAAAAAGATAATGTTGTTGTAGTAGAAGCTCCTATTGAAAGAAGATATTACGATTT
GTCAATTTGCTATGATTTGGTAACATACACTCCTCACTTATTTTTGCAAGGAGTTGATGA
AGATAATGTGCCACTTAAGTAAAACCAAGTATTTGAAGACATTGTCAGTCATTACTCCAA
TAAAACAATCACATTTGAAGTCATGCCTTAAACAGGTAAATAAGCTATCAATCAAGCAAA
GAAACCAAAAAATAAAAAATAAATAATTTAATTTGGCTTTCATTTATACAATTCAAAGAA
AAGCTTCAAAATTAATATTTAAAATATATATTATTAAAGGTATTGTCCAAGCATCTCTCC
ATCCTTGCAAACACTCTCAAGTCATTAAACACATGGTTGATAATATAAATTAATCAGGTG
GCTCAATTAAAAGCCACTAGTGCTTATTCGTTTTCTTGAAATTCTTATAATCTGTGATTC
CCACTATTGAATACGATGTAGCAGGAGACATCATCTTTGACGAGTGA