Identifiers and Description

Gene Model Identifier

TTHERM_00614790

Standard Name

ATG18 (AuTophaGy 18)

Aliases

PreTt19127 | 85.m00120 | 3725.m00013

Description

Autophagy protein; involved in programmed nuclear degradation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00614790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_21121.19.997093137033517e-262hypothetical protein (454 aa)
DictyBaseDDB_G02825818.002082816694397e-20wdr45l on chromosome: 3 positi
on 5969861 to 5971133
OxytrichaContig857.1.g192.0004286606204839e-16WD domain, G-beta repeat
SGDYGR223C0.0000000020002373268528243HSV2 Phosphatidylinositol 3,5-
bisphosphate-binding protein,
plays a role in micronucleopha
gy; predicted to fold as a sev
en-bladed beta-propeller; disp
lays punctate cytoplasmic loca
lization
WormBaseWBGene000126410.000009002574193719714locus:epg-6 status:Confirmed
UniProt:Q86MP3 protein_id
:CAD60426.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22366125: Liu ML, Yao MC (2012) Role of ATG8 and autophagy in programmed nuclear degradation in Tetrahymena thermophila. Eukaryotic cell 11(4):494-506

Sequences

>TTHERM_00614790(coding)
ATGCAAAAGTAAAATATAGTTTCAGGCTTTGAAGTCATAGATAACTTTTCGGATGATGAA
ACACATCCTAATAAATAGCTGAACTAGCCTAGATAATAAAAATCTGATATAAAAAGCTCT
AAATAGCAATCAAAATAAGATGAAAACATTACAAAATAAGAGTAGAAAAATAAAATAGAA
TAGTAATAGCAATTCATAGAAAATTCATAAAACTACGAATAGACAGATGAAACAGATGAC
ACTGAATTTCTGCATAAAAATATTCCAAAGATATATGCAATTACATTTTCGTAAACAGGA
AAAACTGTAGCAATAGGAACTGAAGAAGGGTTGAGAATATAATCATCTGAATCATTAAAA
GTTGGAATGTTAAATAAAAAATATATTATGGAAAAAGAAAAAAACTCTTTTTATTGTGGT
ATTAAGCTTGTTTCTTTAATGTTTGATACTTATATTTGTGCTTTAGTCACTGATAATAAG
AACAAATAATATCCTGATTCTAAAGTTTATATTTGGGATTAAAAAAATAGTCAAATAATA
GGTTAGTATGAATTCTATTCGCCAATTCTATAAATTTGTTATATGAGAGAATTCCTTTTA
GTTGCAAGCGAGTAACGTTTAGTCTTGTATGACATAGTGCAAAAAAAACCACTAAAATAT
ATTTTAGATATATCTACTCCTTAAAAATTTGTAGCTAGCTAACGTTATGACACATTCACC
TTTTGTTATTTAACAAAAAATAAAGGAATGATTATAGCAACAAATGTTTGGTATGACAAC
CCAGTTTAAATTGACTTTAATTAGGAAATAGGCGTTTCTACACCATAATCTTTAGAATAA
AGAGAATTTGATATTTCAAATATGGTTTTAAGTCATGATGGAAGTCTATTAGCTGCCTGC
GAAAAAGGTGGTAATATTATCAAAATTTTTGATACAGAAAAAGGTAAACTCAAATGTACT
CTTTACAGAGGTAAATATCCTAAAATAATTACAGACATGTAATTTAAGAAGGACTTAACT
GCTTTTGGATTAATAAGTACTTATGAATAGAAAAGTGAAGATGAAGGCACTATACATATA
TATGATATATCTATGATAAGTTAATTTAATAAGGAGCCAAATAAAATACCTTTTACTAGG
TTTTAAAATATCAGAAGCTAATAATTCAATTTCGATATTCTCAAAAAATACTCTTATGCA
TCAAAAGATACAAAATTCTAAGGGCCTTTAATTTAATTTGATCCTTAAGGTGGTAATTCA
TTTACTATTTATTCAGAATCTGATTATACACTAAGTTAGGAATATAATTTAACTTCTGAT
GAGCCTAAAAAAAGACTTACAGATAATTAAAAGCAAGATGGATGGATAGATCCTATTTAA
GATGGGTGA


>TTHERM_00614790(protein)
MQKQNIVSGFEVIDNFSDDETHPNKQLNQPRQQKSDIKSSKQQSKQDENITKQEQKNKIE
QQQQFIENSQNYEQTDETDDTEFLHKNIPKIYAITFSQTGKTVAIGTEEGLRIQSSESLK
VGMLNKKYIMEKEKNSFYCGIKLVSLMFDTYICALVTDNKNKQYPDSKVYIWDQKNSQII
GQYEFYSPILQICYMREFLLVASEQRLVLYDIVQKKPLKYILDISTPQKFVASQRYDTFT
FCYLTKNKGMIIATNVWYDNPVQIDFNQEIGVSTPQSLEQREFDISNMVLSHDGSLLAAC
EKGGNIIKIFDTEKGKLKCTLYRGKYPKIITDMQFKKDLTAFGLISTYEQKSEDEGTIHI
YDISMISQFNKEPNKIPFTRFQNIRSQQFNFDILKKYSYASKDTKFQGPLIQFDPQGGNS
FTIYSESDYTLSQEYNLTSDEPKKRLTDNQKQDGWIDPIQDG


>TTHERM_00614790(gene)
ATGCAAAAGTAAAATATAGTTTCAGGCTTTGAAGTCATAGATAACTTTTCGGATGATGAA
ACACATCCTAATAAATAGCTGAACTAGCCTAGATAATAAAAATCTGATATAAAAAGCTCT
AAATAGCAATCAAAATAAGATGAAAACATTACAAAATAAGAGTAGAAAAATAAAATAGAA
TAGTAATAGCAATTCATAGAAAATTCATAAAACTACGAATAGACAGATGAAACAGATGAC
ACTGAATTTCTGCATAAAAATATTCCAAAGATATATGCAATTACATTTTCGTAAACAGGA
AAAACTGTAGCAATAGGAACTGAAGAAGGGTTGAGAATATAATCATCTGAATCATTAAAA
GTTGGAATGTTAAATAAAAAATATATTATGGAAAAAGAAAAAAACTCTTTTTATTGTGGT
ATTAAGCTTGTTTCTTTAATGTTTGATACTTATATTTGTGCTTTAGTCACTGATAATAAG
AACAAATAATATCCTGATTCTAAAGTTTATATTTGGGATTAAAAAAATAGTCAAATAATA
GGTTAGTATGAATTCTATTCGCCAATTCTATAAATTTGTTATATGAGAGAATTCCTTTTA
GTTGCAAGCGAGTAACGTTTAGTCTTGTATGACATAGTGCAAAAAAAACCACTAAAATAT
ATTTTAGATATATCTACTCCTTAAAAATTTGTAGCTAGCTAACGTTATGACACATTCACC
TTTTGTTATTTAACAAAAAATAAAGGTAGAATTATATTATTAAAAATTATATTTAAAATG
ATAATATTTTCTTTAAAATAAAAGGAATGATTATAGCAACAAATGTTTGGTATGACAACC
CAGTTTAAATTGACTTTAATTAGGAAATAGGCGTTTCTACACCATAATCTTTAGAATAAA
GAGAATTTGATATTTCAAATATGGTTTTAAGTCATGATGGAAGTCTATTAGCTGCCTGCG
AAAAAGGTGGTAATATTATCAAAATTTTTGATACAGAAAAAGGTAAACTCAAATGTACTC
TTTACAGAGGTAAATATCCTAAAATAATTACAGACATGTAATTTAAGAAGGACTTAACTG
CTTTTGGATTAATAAGTACTTATGAATAGAAAAGTGAAGATGAAGGCACTATACATATAT
ATGATATATCTATGATAAGTTAATTTAATAAGGAGCCAAATAAAATACCTTTTACTAGGT
TTTAAAATATCAGAAGCTAATAATTCAATTTCGATATTCTCAAAAAATACTCTTATGCAT
CAAAAGATACAAAATTCTAAGGGCCTTTAATTTAATTTGATCCTTAAGGTGGTAATTCAT
TTACTATTTATTCAGAATCTGATTATACACTAAGTTAGGAATATAATTTAACTTCTGATG
AGCCTAAAAAAAGACTTACAGATAATTAAAAGCAAGATGGATGGATAGATCCTATTTAAG
ATGGGTGA