Identifiers and Description

Gene Model Identifier

TTHERM_00012980

Standard Name

ATG10 (Autophagy protein 10)

Aliases

PreTt11805 | 1.m00853

Description

Autophagy protein 10

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

  • ( PF03986 ) Autophagocytosis associated protein, N-terminal domain
  • ( PF03987 ) Autophagocytosis associated protein, C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00012980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02752.12.0004683842646898e-122autophagocytosis associated pr
otein domain-containing protei
n (225 aa)
OxytrichaContig10290.0.g219.99648502569394e-38Autophagocytosis associated pr
otein (Atg3), N-terminal domai
n
DictyBaseDDB_G02773194.00073564232477e-35atg3 on chromosome: 2 position
7690557 to 7691968
WormBaseWBGene000219225.001425520048966e-32locus:atg-3 Autophagy-relate
d protein 3 status:Confirmed
UniProt:Q9N369 protein_id
:CCD74062.1
SGDYNR007C9.000561397357242e-21ATG3 E2-like enzyme involved i
n autophagy and the cytoplasm-
to-vacuole targeting (Cvt) pat
hway; plays a role in formatio
n of Atg8p-phosphatidylethanol
amine conjugates, which are in
volved in membrane dynamics du
ring autophagy and Cvt
Stentor CoeruleusSteCoe_78094.248354255291589e-18

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22366125: Liu ML, Yao MC (2012) Role of ATG8 and autophagy in programmed nuclear degradation in Tetrahymena thermophila. Eukaryotic cell 11(4):494-506

Sequences

>TTHERM_00012980(coding)
ATGAATGCATTTAGTAATTTTGTTAGCTCATTTAAGACACCATCACCTGAAGATTTTGAT
AAGCATGGTTTTTTGACTCCTAAGTAATTTTTGGAATCAGGTGATTAATTAACTTTAATG
GGATGGAAGTGGGAAAAGGTCGATGACAATAAAAAGCTCAACAAAAGTTTGACAGATCCT
AAAAAGTAGTTTTTAACCTTTTAGGGAAGAAGTTTAACAGAATCAAAAAGAATGTTTTTG
ATGATTTAGAAGAGAAAGTTAATAGTGAAGGATTTGTTGAGACTAGCCAACAAGAAAGCT
AAAAAAAAGCAAATAAATCGTTAATCAAATGCTTAAGATAATCAAGAAGAAGAAGAAGAA
ATGAGAATATATAACTTTTCTATTACTTATGACACTTATTATCATGTTCCAAGAATTTGG
TTTTCTGGAGTTGATGAAAACCAAAAACCTTTAAAGAAAGAATAAATGTTCGAAGATGTA
ATGCCAGAGTATAGAGACGAAACAGTCACCCTTGAAAAACACCCTCACTTAGGATATGAT
TAAATGACAATCCACCCTTGCAAACACTCATAAATCCTTAAAAGTTTTATTGATCAAGCA
AAGGAAAATGGAAGAACTATTAAACCTAATCAAGCCCTTATTATTTTCCTTAAATTCGTA
GGCTCAGTTCTACCCACTTTAGAAATAGAAACAACTACAGATTTAGAGATTTGA


>TTHERM_00012980(protein)
MNAFSNFVSSFKTPSPEDFDKHGFLTPKQFLESGDQLTLMGWKWEKVDDNKKLNKSLTDP
KKQFLTFQGRSLTESKRMFLMIQKRKLIVKDLLRLANKKAKKKQINRQSNAQDNQEEEEE
MRIYNFSITYDTYYHVPRIWFSGVDENQKPLKKEQMFEDVMPEYRDETVTLEKHPHLGYD
QMTIHPCKHSQILKSFIDQAKENGRTIKPNQALIIFLKFVGSVLPTLEIETTTDLEI


>TTHERM_00012980(gene)
ATGAATGCATTTAGTAATTTTGTTAGCTCATTTAAGACACCATCACCTGAAGATTTTGAT
AAGCATGGTTTTTTGACTCCTAAGTAATTTTTGGAATCAGGTGATTAATTAACTTTAATG
GGATGGAAGTGGGAAAAGGTCGATGACAATAAAAAGCTCAACAAAAGTTTGACAGATCCT
AAAAAGTAGTTTTTAACCTTTTAGGGAAGAAGTTTAACAGAATCAAAAAGAATGTTTTTG
ATGATTTAGAAGAGAAAGTTAATAGTGAAGGATTTGTTGAGACTAGCCAAGTAATTTTCT
TAAATTTCTTTTATTTGTGTAAAACCAATTTGTTGTTGAAACAAAAAAAAAACAACTTCA
AAAAATTTTAATAGCAAGAAAGCTAAAAAAAAGCAAATAAATGTAAAATTTAAAAAAACC
TATATCTGATTCGTTCTTTATATAAATATTTAGCGTTAATCAAATGCTTAAGATAATCAA
GAAGAAGAAGAAGAAATGAGAATATATAACTTTTCTATTACTTATGACACTTATTATCAT
GTTCCAAGAATTTGGTTTTCTGGAGTTGATGAAAACCAAAAACCTTTAAAGAAAGAATAA
ATGTTCGAAGATGTAATGCCAGAGTATAGAGACGAAACAGTAATAATTTTAATTTTGCAA
TTAAATGATTGATCGATTAGATGCAAATCAATTTAATTTTATGTAATTTTAACATTAATT
TAAATCAAAAAAGGTCACCCTTGAAAAACACCCTCACTTAGGATATGATTAAATGACAAT
CCACCCTTGCAAACACTCATAAATCCTTAAAAGTTTTATTGATCAAGCAAAGGAAAATGG
AAGAACTATTAAACCTAATCAAGCCCTTATTATTTTCCTTAAATTCGTAGGCTCAGTTCT
ACCCACTTTAGAAATAGAAACAACTACAGATTTAGAGATTTGA