Identifiers and Description

Gene Model Identifier

TTHERM_00624760

Standard Name

ATA2 (ATP Transport Apparatus 2-(types of domains) )

Aliases

PreTt07464 | 87.m00244 | 3814.m00945

Description

ABC transporter family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00624760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12050.19.997093137033517e-262ABC transporter (1422 aa)
DictyBaseDDB_G02805415.998558726299043e-153abcC1 on chromosome: 3 positio
n 3500769 to 3505118
WormBaseWBGene000034084.999555668078159e-151locus:mrp-2 status:Confirmed
UniProt:Q20943 protein_id
:CCD69448.1
SGDYDR135C9.99668353155528e-144YCF1 Vacuolar glutathione S-co
njugate transporter of the ATP
-binding cassette family, has
a role in detoxifying metals s
uch as cadmium, mercury, and a
rsenite; also transports uncon
jugated bilirubin; similar to
human cystic fibrosis protein
CFTR
OxytrichaContig7364.0.0.g834.001794290548151e-138ABC transporter
Stentor CoeruleusSteCoe_86468.628801156620959e-60

General Information

Paragraph NoGene NameParagraph Text
45ATA2 ATA2 from the eukaryote Tetrahymena thermophila is similar to ATA homologs from other eukaryotes. It contains two of each of the two types of domains, an ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD), totaling four domains. The 3D structure of an ABC is a stubby L-shape with two distinct arms. These transporters function as dimers. The purpose of the binding cassettes (approximately 200 amino acid residues) is to bind and hydrolyze ATP, which releases energy that enables the transporters to transfer macromolecules and ions across cellular membranes. This most commonly occurs in the transport of essential nutrients to bacteria, but also is related to diseases such as cystic fibrosis in humans. It is clear that ATA2 is important as we can see that it is strongly conserved across many organisms from Homo sapiens to Drosophila. Paragraph provided by Aish Subramanian and Travis Tu at the Keck Science Department of Claremont McKenna, Pitzer, and Scripps Colleges.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00624760(coding)
ATGAGTGATTAACAAAGCTCTGCAACAAGGGACTCAATTGATATTGAAAGTTATCATTTA
TAGAAAGGATAAAAGCTATTGGATCAATCTTAAAATTTTAAATCTGAAAATCAATCAGAT
TCTTAATTTTAAAATGGGGCACTTAAAAATACAGATAAAAAAGGCTATAACTCATTTAGT
TAAGGCTATTCATGCATTTGGCGATTAATTTGGTTTCACTTTATAAGCATGGTTAAAAAA
TTAAAAAATATAGAATAACAAGGAAGAAGAATAGAAGTTGATGATCTGCCAGAGCTTGAA
GATCATGCTAAAGTAGAGTATACAGCTTACAAGTTGAAAGAAAAAATAGAAAAATTAGAC
CCTGAAAAAGTAACTTCTTTAGGGTTTTTGAAAATAATTGGATTGGCTTTCAAGAAAAGT
GTGTTGGCAATCATGACATTTTTATTTTTAGAGAATATAACTAAATTAATGGTTCCATAT
TGTATGCAAAAACTAATTTAACTTGTAAAAGAAGGTGATATTTAGTAAGCATCATTATGG
GTATTTTTACTTGTATTTTCGAGCTTTTTAGGGATTACATTTGGTTAAAATGGTTGGACA
GGCTCTTAAAGATTATGCGCTCAACTGAGATTAGGACTAATCAATATACTGTATTAAAAA
GTTAGTAACTTATCAGCTTTCTCAGTTAAAAAAGCTAATGTAGGAAAAATTATTAATATG
ATATCCTCTGATTTTAGTATTTTTGAAGTTAGAGCTGTGAATATATTCACCACAGCTTTA
GCTCCAATAACTTTATCTATTTCTTGTGGTATGCTTTGCTATAGAATTGGATATATTGCA
ATACCAGCCATTTTTCTTATGATAGGACTTTTTCCACTTTAAAAAAAAATAGCCTAAGCA
GCGTCTGAATATACAAAACAGTAGTCAAAGCATAGTGATTAAAAGATAAAGCTTTTTTCT
GAAATGATGGATGGTATAAGAATCATAAAAATGTATGGTTGGGAAAAAGCTTTTAATTCA
ACAATTAATAAGTTCAGAAGTTTAGAGGTAAGAAATACACTAATAAACCAAATTATTATG
TATATAGAGCATGCATTTAGTTTAAACGGTCCATTGTTTGTAGCTCTGCTTTGTTTTTTA
TTTATTGACATGTATGAAGATAACTTTCTTGATACTGCAATAATATTTTCAACCATTGAA
CTGATAAATTTAATCTCAAACACTATTATGAAGAATGTAGGTTATGGATTAAGTTTTATA
TTTGAGTTTAAAGTTCTTGTCTAAAGATATATGAGTGTTATATCTATTGAAAATGTATAG
ATGAAAAGCATTGATAATCCTCACATGAAACCCAACTTAGCAGATAATCCACCTTCTCCA
GATACACTTGTGTATATGAAAGATTTTTCAGCATATTGGTAGACTGAAGATTTAGAAAAT
CAAACACCTGTTTTGTAGGACATTAACTTTACAATCAAAAAAGGAGAAACTGTTTCTATC
ATTGGATAAATAGGAAGTGGAAAGACTTCCTTCCTTTTTGCTATAATGCAGGAGATACCT
CGCTATAAAGGTGTTTACTATTCTGTTTCTCAAATTTCCTTTGCCGAATAGGAACCCTTC
ATTCTTTAGGGAACTGTTAGAGATAACATTTTGTTTGGTAAGTCTTATGATGAAAAATTC
TACAAAAAAGTTGTCAAAGCTTGTTGTTTGCTTGATGATTACAAATAGTTTTCAAACGGA
GATCTAACAGTTGTTGGCGAAAGAGGTTCAAATTTAAGTGGAGGATAAAAAGCAAGAATA
TGTTTAGCAAGAGCAGTTTACGCAGATACAGATTTATATCTGTTAGATGACCCTCTTTCT
GCTGTAGACTCTAAAGTTGCTAAAAAAATATTCAAAAATGTTATAAATGGAATGCTCAAA
GACAAAGGAGTAATATTGGTCACACACTAGCTAAATTATGCTCTCAGATGTTAGAGGATT
GCAGTTTTCGAGAATGGAAATATTATTTTGTAGGGTAATCCTAATGAGATAAATTTCTCA
TAGACCTCTTTGGCAAAGCATATTGAGAATATTGAAAATCATCACGTAGAAGATGAAAAC
TAGTTAGATATTTCTATGGAATAGCAAATTCTTTAAGAAATTTAAAAGGAAGAGGATGAA
TAAGACAATGATGATGAAAATCAAGACAGTTCTACTAAATAAAAAGATATTCAAACTTTT
AAAAATGACAAAGAGATAAATAATGTTATTAAACCAAATGAAGATAGAAATTCTACTATT
TTCTCAAGCAGTGGAAAAAAGGAAGACGAATATCCAGTTACTAAAGATACATACATAAAT
TATTTCTTAACAAATCCTTCACCTTGGATATTTATGCTAGTAGTCTTTACATTTATTATT
TAGGAATTCCTATTTACTAGCTTTTACAAGTCTCTCTCGCTGTATGAATACGAATTTAAT
CGAGAATAATTCTATGCTATTTCTTTTGGAATCTTGACAGCATTTTTTGTATTTAAATTC
GTTTAATGCTCATTCATGTCTTACTTCGTATTACAGACAAATTAAAGTCTTACTTAAAAA
ATGATCAGAAGTATTTCTTAGGCTAGACCTATTTTATTTGATGAGATTCCTTCAGGACAA
ATCATAAATAAATATTCTACTGATATCTCAATATTAGATAAAAATTTGCCTGAAGCAGCC
CAATAAACAGTTGAAGGTGTATTGCACTTCATTAATCTAATTGGCTCTGTAATCTTCATT
AACTAGTATTTTATTATTCCTGGAGTTTTTGAAGTCTTTCTATTCTATAAATGGTTTAGA
TATATTAAACCAACTCTTATGCGTGCTAAGTAGCTAGATCTTGAAAATAAGACTCCAGTT
TTTCAATTTTTCTAAAGCTCTCTAAATGGCATTTTAATCATCAACATATATGGGCAAAAG
CAACTATTTTAATAAAAAATGGCTGTTCTTATGAATAATAGTATCAGGACAGCTGATATT
TTTTGGTTTGTTTCACGTTTGTTCAGTGTTAGCATGTAGTATTTTGCTTTAGCTGTTTCA
GGTGTTGGAATTTATATCATTTTATTCTTATCAAGCTCTGATAATCCCAAATTTGCAGAA
TCTTTAACCTATTTGCTGTTACTCACTAACTTTTTGCATATGACTTTGCGTGCTGTTATT
AATATGGACACTTTTATGACAAGTAGTGAACGTGCATGTTCTATAATAGATTTACCAAGA
GAAAATATTGAACTTAGTGATATTGACAGTGATTAATTAACCCACGATGATCACTAACAT
CATTAAACTTCATAAAATAGTTAAAGAAATAGGCATTATAACTAATTATAAAGTGAATAA
AGTTCGGTATCAATTGAAATAGAAGATTTTAACTAAGAGCGTTTAAACAAAAACTCAATA
TAAAGTAATAAATGGCCATCATAGGGCAATTTAAAATTTGATAATGTGTTTATGAGATAT
AAAGAAGGAATGAATCCAGTACTAAAAGGGGTAAGTTTTGAAGCTAAACCTCTAGAACGC
GTAGCTATTGTTGGGAGAACCGGAGCAGGAAAATCTTCCATTATTTAGGCTTTATTTAGA
ATGAGCGAAATAGACATTTCTTCAGAATAAGGACCTTCTCGCATATTTTATGATGATTAA
AATACAAGAGATGTGGGACTTCATTTACTAAGAAGAAGCATTAGCATTATCCCATAAAAT
CCTTTTGTTTTTAGTGGATCTATCCGCAGAAATATTGATCCGCTTGATGAATATACAGAT
CAATAAATCTATCATGTTTTAAGAGAAACTGGTTTAAATGAGTTAATATCAAAGCTTCCA
TAAGGTATAGAAACTGATATGAGTGACTCGGCATCAGTGTTCTCTATGGGACAAAGATAA
TTAGTTTGCCTAGCAAGAGTTATGCTTAGACGCAATAAGCTGATGGTTTTAGATGAAGCA
ACTGCAAATGTAGACATGGAAACTGACCACTTAATTTAGGAATTAATTAAGGAAAAATTC
TAAGATACAACTATAATAACAATAGCGCATAGACTAAATACTATCGCTGATTATGATAAA
ATTATTGTTTTGGATGCAGGTAAAGTTGTTGAAATCGATACTCCATTTAATTTACTTGCT
CTACGTGAGGAAGATTAAACTATTACTAACACTGAAAGTGTTTTTGCATAAATGGTACTA
AATACGGGTGCTAAAAATGGAGAGCAGATCTTCTAAATATGCAAGAAATCTTATCTTGAG
AAGAAAAAGAACATTTGA


>TTHERM_00624760(protein)
MSDQQSSATRDSIDIESYHLQKGQKLLDQSQNFKSENQSDSQFQNGALKNTDKKGYNSFS
QGYSCIWRLIWFHFISMVKKLKNIEQQGRRIEVDDLPELEDHAKVEYTAYKLKEKIEKLD
PEKVTSLGFLKIIGLAFKKSVLAIMTFLFLENITKLMVPYCMQKLIQLVKEGDIQQASLW
VFLLVFSSFLGITFGQNGWTGSQRLCAQLRLGLINILYQKVSNLSAFSVKKANVGKIINM
ISSDFSIFEVRAVNIFTTALAPITLSISCGMLCYRIGYIAIPAIFLMIGLFPLQKKIAQA
ASEYTKQQSKHSDQKIKLFSEMMDGIRIIKMYGWEKAFNSTINKFRSLEVRNTLINQIIM
YIEHAFSLNGPLFVALLCFLFIDMYEDNFLDTAIIFSTIELINLISNTIMKNVGYGLSFI
FEFKVLVQRYMSVISIENVQMKSIDNPHMKPNLADNPPSPDTLVYMKDFSAYWQTEDLEN
QTPVLQDINFTIKKGETVSIIGQIGSGKTSFLFAIMQEIPRYKGVYYSVSQISFAEQEPF
ILQGTVRDNILFGKSYDEKFYKKVVKACCLLDDYKQFSNGDLTVVGERGSNLSGGQKARI
CLARAVYADTDLYLLDDPLSAVDSKVAKKIFKNVINGMLKDKGVILVTHQLNYALRCQRI
AVFENGNIILQGNPNEINFSQTSLAKHIENIENHHVEDENQLDISMEQQILQEIQKEEDE
QDNDDENQDSSTKQKDIQTFKNDKEINNVIKPNEDRNSTIFSSSGKKEDEYPVTKDTYIN
YFLTNPSPWIFMLVVFTFIIQEFLFTSFYKSLSLYEYEFNREQFYAISFGILTAFFVFKF
VQCSFMSYFVLQTNQSLTQKMIRSISQARPILFDEIPSGQIINKYSTDISILDKNLPEAA
QQTVEGVLHFINLIGSVIFINQYFIIPGVFEVFLFYKWFRYIKPTLMRAKQLDLENKTPV
FQFFQSSLNGILIINIYGQKQLFQQKMAVLMNNSIRTADIFWFVSRLFSVSMQYFALAVS
GVGIYIILFLSSSDNPKFAESLTYLLLLTNFLHMTLRAVINMDTFMTSSERACSIIDLPR
ENIELSDIDSDQLTHDDHQHHQTSQNSQRNRHYNQLQSEQSSVSIEIEDFNQERLNKNSI
QSNKWPSQGNLKFDNVFMRYKEGMNPVLKGVSFEAKPLERVAIVGRTGAGKSSIIQALFR
MSEIDISSEQGPSRIFYDDQNTRDVGLHLLRRSISIIPQNPFVFSGSIRRNIDPLDEYTD
QQIYHVLRETGLNELISKLPQGIETDMSDSASVFSMGQRQLVCLARVMLRRNKLMVLDEA
TANVDMETDHLIQELIKEKFQDTTIITIAHRLNTIADYDKIIVLDAGKVVEIDTPFNLLA
LREEDQTITNTESVFAQMVLNTGAKNGEQIFQICKKSYLEKKKNI


>TTHERM_00624760(gene)
ATGAGTGATTAACAAAGCTCTGCAACAAGGGACTCAATTGATATTGAAAGTTATCATTTA
TAGAAAGGATAAAAGCTATTGGATCAATCTTAAAATTTTAAATCTGAAAATCAATCAGAT
TCTTAATTTTAAAATGGGGCACTTAAAAATACAGATAAAAAAGGCTATAACTCATTTAGT
TAAGGCTATTCATGCATTTGGCGATTAATTTGGTTTCACTTTATAAGCATGGTTAAAAAA
TTAAAAAATATAGAATAACAAGGAAGAAGAATAGAAGTTGATGATCTGCCAGAGCTTGAA
GATCATGCTAAAGTAGAGTATACAGCTTACAAGTTGAAAGAAAAAATAGAAAAATTAGAC
CCTGAAAAAGTAACTTCTTTAGGGTTTTTGAAAATAATTGGATTGGCTTTCAAGAAAAGT
GTGTTGGCAATCATGACATTTTTATTTTTAGAGAATATAACTAAATTAATGGTTCCATAT
TGTATGCAAAAACTAATTTAACTTGTAAAAGAAGGTGATATTTAGTAAGCATCATTATGG
GTATTTTTACTTGTATTTTCGAGCTTTTTAGGGATTACATTTGGTTAAAATGGTTGGACA
GGCTCTTAAAGATTATGCGCTCAACTGAGATTAGGACTAATCAATATACTGTATTAAAAA
GTTAGTAACTTATCAGCTTTCTCAGTTAAAAAAGCTAATGTAGGAAAAATTATTAATATG
ATATCCTCTGATTTTAGTATTTTTGAAGTTAGAGCTGTGAATATATTCACCACAGCTTTA
GCTCCAATAACTTTATCTATTTCTTGTGGTATGCTTTGCTATAGAATTGGATATATTGCA
ATACCAGCCATTTTTCTTATGATAGGACTTTTTCCACTTTAAAAAAAAATAGCCTAAGCA
GCGTCTGAATATACAAAACAGTAGTCAAAGCATAGTGATTAAAAGATAAAGCTTTTTTCT
GAAATGATGGATGGTATAAGAATCATAAAAATGTATGGTTGGGAAAAAGCTTTTAATTCA
ACAATTAATAAGTTCAGAAGTTTAGAGGTAAGAAATACACTAATAAACCAAATTATTATG
TATATAGAGCATGCATTTAGTTTAAACGGTCCATTGTTTGTAGCTCTGCTTTGTTTTTTA
TTTATTGACATGTATGAAGATAACTTTCTTGATACTGCAATAATATTTTCAACCATTGAA
CTGATAAATTTAATCTCAAACACTATTATGAAGAATGTAGGTTATGGATTAAGTTTTATA
TTTGAGTTTAAAGTTCTTGTCTAAAGATATATGAGTGTTATATCTATTGAAAATGTATAG
ATGAAAAGCATTGATAATCCTCACATGAAACCCAACTTAGCAGATAATCCACCTTCTCCA
GATACACTTGTGTATATGAAAGATTTTTCAGCATATTGGTAGACTGAAGATTTAGAAAAT
CAAACACCTGTTTTGTAGGACATTAACTTTACAATCAAAAAAGGAGAAACTGTTTCTATC
ATTGGATAAATAGGAAGTGGAAAGACTTCCTTCCTTTTTGCTATAATGCAGGAGATACCT
CGCTATAAAGGTGTTTACTATTCTGTTTCTCAAATTTCCTTTGCCGAATAGGAACCCTTC
ATTCTTTAGGGAACTGTTAGAGATAACATTTTGTTTGGTAAGTCTTATGATGAAAAATTC
TACAAAAAAGTTGTCAAAGCTTGTTGTTTGCTTGATGATTACAAATAGTTTTCAAACGGA
GATCTAACAGTTGTTGGTAATTAATTTAATACTTTTATTTAGAATTAAAATCTTAAATAA
ATATTTTTAAACTATCTATATATTATGAATAGGCGAAAGAGGTTCAAATTTAAGTGGAGG
ATAAAAAGCAAGAATATGTTTAGCAAGAGCAGTTTACGCAGATACAGATTTATATCTGTT
AGATGACCCTCTTTCTGCTGTAGACTCTAAAGTTGCTAAAAAAATATTCAAAAATGTTAT
AAATGGAATGCTCAAAGACAAAGGAGTAATATTGGTCACACACTAGCTAAATTATGCTCT
CAGATGTTAGAGGATTGCAGTTTTCGAGAATGGAAATATTATTTTGTAGGGTAATCCTAA
TGAGATAAATTTCTCATAGACCTCTTTGGCAAAGCATATTGAGAATATTGAAAATCATCA
CGTAGAAGATGAAAACTAGTTAGATATTTCTATGGAATAGCAAATTCTTTAAGAAATTTA
AAAGGAAGAGGATGAATAAGACAATGATGATGAAAATCAAGACAGTTCTACTAAATAAAA
AGATATTCAAACTTTTAAAAATGACAAAGAGATAAATAATGTTATTAAACCAAATGAAGA
TAGAAATTCTACTATTTTCTCAAGCAGTGGAAAAAAGGAAGACGAATATCCAGTTACTAA
AGATACATACATAAATTATTTCTTAACAAATCCTTCACCTTGGATATTTATGCTAGTAGT
CTTTACATTTATTATTTAGGAATTCCTATTTACTAGCTTTTACAAGTCTCTCTCGCTGTA
TGAATACGAATTTAATCGAGAATAATTCTATGCTATTTCTTTTGGAATCTTGACAGCATT
TTTTGTATTTAAATTCGTTTAATGCTCATTCATGTCTTACTTCGTATTACAGACAAATTA
AAGTCTTACTTAAAAAATGATCAGAAGTATTTCTTAGGCTAGACCTATTTTATTTGATGA
GATTCCTTCAGGACAAATCATAAATAAATATTCTACTGATATCTCAATATTAGATAAAAA
TTTGCCTGAAGCAGCCCAATAAACAGTTGAAGGTGTATTGCACTTCATTAATCTAATTGG
CTCTGTAATCTTCATTAACTAGGTATAAATTTTAATTAACTTTTGAAAATTTTAAAAAAA
AAAATAATTTTTATTCTAAAAAAGTATTTTATTATTCCTGGAGTTTTTGAAGTCTTTCTA
TTCTATAAATGGTTTAGATATATTAAACCAACTCTTATGCGTGCTAAGTAGCTAGATCTT
GAAAATAAGACTCCAGTTTTTCAATTTTTCTAAAGCTCTCTAAATGGCATTTTAATCATC
AACATATATGGGCAAAAGCAACTATTTTAATAAAAAATGGCTGTTCTTATGAATAATAGT
ATCAGGACAGCTGATATTTTTTGGTTTGTTTCACGTTTGTTCAGTGTTAGCATGTAGTAT
TTTGCTTTAGCTGTTTCAGGTGTTGGAATTTATATCATTTTATTCTTATCAAGCTCTGAT
AATCCCAAATTTGCAGAATCTTTAACCTATTTGCTGTTACTCACTAACTTTTTGCATATG
ACTTTGCGTGCTGTTATTAATATGGACACTTTTATGACAAGTAGTGAACGTGCATGTTCT
ATAATAGATTTACCAAGAGAAAATATTGAACTTAGTGATATTGACAGTGATTAATTAACC
CACGATGATCACTAACATCATTAAACTTCATAAAATAGTTAAAGAAATAGGCATTATAAC
TAATTATAAAGTGAATAAAGTTCGGTATCAATTGAAATAGAAGATTTTAACTAAGAGCGT
TTAAACAAAAACTCAATATAAAGTAATAAATGGCCATCATAGGGCAATTTAAAATTTGAT
AATGTGTTTATGAGATATAAAGAAGGAATGAATCCAGTACTAAAAGGGGTAAGTTTTGAA
GCTAAACCTCTAGAACGCGTAGCTATTGTTGGGAGAACCGGAGCAGGAAAATCTTCCATT
ATTTAGGCTTTATTTAGAATGAGCGAAATAGACATTTCTTCAGAATAAGGACCTTCTCGC
ATATTTTATGATGATTAAAATACAAGAGATGTGGGACTTCATTTACTAAGAAGAAGCATT
AGCATTATCCCATAAAATCCTTTTGTTTTTAGTGGATCTATCCGCAGAAATATTGATCCG
CTTGATGAATATACAGATCAATAAATCTATCATGTTTTAAGAGAAACTGGTTTAAATGAG
TTAATATCAAAGCTTCCATAAGGTATAGAAACTGATATGAGTGACTCGGCATCAGTGTTC
TCTATGGGACAAAGATAATTAGTTTGCCTAGCAAGAGTTATGCTTAGACGCAATAAGCTG
ATGGTTTTAGATGAAGCAACTGCAAATGTAGACATGGAAACTGACCACTTAATTTAGGAA
TTAATTAAGGAAAAATTCTAAGATACAACTATAATAACAATAGCGCATAGACTAAATACT
ATCGCTGATTATGATAAAATTATTGTTTTGGATGCAGGTAAAGTTGTTGAAATCGATACT
CCATTTAATTTACTTGCTCTACGTGAGGAAGATTAAACTATTACTAACACTGAAAGTGTT
TTTGCATAAATGGTACTAAATACGGGTGCTAAAAATGGAGAGCAGATCTTCTAAATATGC
AAGAAATCTTATCTTGAGAAGAAAAAGAACATTTGA