Identifiers and Description

Gene Model Identifier

TTHERM_00191480

Standard Name

ASI2 (Anlagen Stage Induced )

Aliases

PreTt08799 | 15.m00510 | 3697.m00221

Description

Similar to anlagen stage induced protein 1 (ASI1); protein of unknown function; gene is located adjacent to the ASI1 gene

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00672 ) HAMP domain
  • ( PF02743 ) Cache domain
  • ( PF02326 ) YMF19 hypothetical plant mitochondrial protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00191480

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06168.19.997093137033517e-262ASI2 protein (724 aa)

General Information

Paragraph NoGene NameParagraph Text
85ASI2Gene Information: ASI2 is a gene regulating endocycling in Tetrahymena thermophila. Though nonessential for vegative growth, it is upregulated after meiosis and is involved in the creation of a new MAC. Introduced via transduction with ASI2-GFP plasmid to establish parental cells that showed transcription of ASI2 occurs both in MAC and parental cells at conjugation.
86ASI2Nucleic Acid Interactions: ASI2p independent of ssRNA synthesis/accumulation
87ASI2Regulation & Expression: The Tetrahymena gene ASI1 (anlagen stage induced 1) was isolated from a cDNA library of genes that are up-regulated during development of the macronuclear anlagen. As its name implies, the abundance of ASI2 mRNA peaks at 9 h of mating, early in macronuclear anlagen development.

Associated Literature

  1. Ref:20656911: Yin L, Gater ST, Karrer KM (2010) A developmentally regulated gene, ASI2, is required for endocycling in the macronuclear anlagen of Tetrahymena. Eukaryotic cell 9(9):1343-53
  2. Ref:16712831: Li S, Yin L, Cole ES, Udani RA, Karrer KM (2006) Progeny of germ line knockouts of ASI2, a gene encoding a putative signal transduction receptor in Tetrahymena thermophila, fail to make the transition from sexual reproduction to vegetative growth. Developmental biology 295(2):633-46

Sequences

>TTHERM_00191480(coding)
ATGACACAAACGGAACTCGTTCCTGAAGATTATGACCAGGATAATTAAGATGCTTCTCAA
AGCGTAATCTCTTCAGGAAGCGTTGAAGATGGAAAAGAAAAATTTAAAGCAATGATACAT
AAAATTTTAGGAGTAAACGATAACAAATAAATAGATAAAATATGCTGTTTCTCCATTTTT
AATAAGCAGTGGTCTCGTACAAAGCAACTGTTTTGTGTTTACTCAGTCTTTTTGACATTA
TTTATGACTATAATATTAGGGTGTTTTGTGTTCTACTTAAAATTTTGTCCCAATTTCGTA
GGAGATACAATCTTAGAGTAGATTGATAACTCAATTTCTGCAAGCTTTTAAAATTCCTTA
CTTGAATACAGTAAATAAGTACATTAATATTTCAAAGCATATAGTTCTTGGATGATTATG
TTCTCCCAAATAGTAGCTAACAATGTTGGTTGGAATAATTCACTATATTAATCCTCAAAC
GAATTAAATTTATAACCACAACAAAAATATTTTCCTATTTATTAGCCTATCCCATAAAAT
ATAGTAAATAAGTAATATTCTTAGAAAAAGCCCTATTATGATAAAGATATATCATTTTAA
ACTTTTTCTTATTTTCACAACCATCCTGACGATGCAACTACTATTTCACCAGCTACTTAA
ACATATTTGGACTCTGTAGACTTGATTTCTTATTTTTTTTCTAATTTTATATAAGATCCT
AATTTAACTTATGTCTAGTCTTTATATATTTACCTTTAAGATCGAGATGTCATTTGTTTT
TTTCCAGCAGGCCTCATTAAAGTCCCAAAAGATTTTAAGATAGATATGAAATAAAGGCCT
TGGTATTTAAATACTGCTTAAACATTTTAAGCCAATGGAAATAAACCTGTATTTACAATT
ACCAGTCCCTATCCTGATTTAACTACTAAATAAATAACTATAACATACTCCCTTGCAATC
GTCAAACAGTCAGATCCTACTTAAATTGCTGGAGTTATTAATGTAGATGTTATTGTTGGT
AATTTTAGATCTGTTTATGACTTGCTGCAGGAAAAAGATGGTGAATTTTAAATTGCCTTA
GTAGATTATAATACAGAATACATCATTAATGATTGCTTTAATTAAAGTGGAATTTCACAT
TTTTATGATACGAATAATACAAACTTTACACTTGAAAATTGGAATGAAATCAAAGATTTT
AATTAACACCAATAAAGTTAAACATTCATCATTACTAATAGTTAGAATGTAAGATATTAT
TTTGCTCGTACTTTAATAAAAGATACAGTAAATCAAACATTAAATAGATTTTATCTTATC
GTCTTTGGTAAAGAAAGCAATTATCTCTCCTATAGAAACAATATTTAAGATAGAATATAT
AATGAGCTCTATAACTTTTGCATATCATTAATAATTGCTTTTTCTATTTTGTGGTTCTTT
TCATATTTCTATATCTATGCTCTATCACGCAATATTGTTCTACCGCTTTTTAAATTGAGT
TAATTAGCTAAAAGTATAAACAAGCACGATGAGAGAAAAAGCTCTGCTGAAGACTTGAAA
GAATAGTTAGGTAAGATTTAAGGTGCAGATACTGATACAAAAAAGCTTATCGATTCTTTC
ATTAACCTTGTAGATTAGCACTCTGGCATGAGAAAACTAGCAAATGGTAATGGTTACTAA
GACAATATGATCCCAGTCTACAATAGAATGAGCAACATTTATGAAAACTATTCTAGGAAT
GACTACAGAGAAGAATTGGATGATATATAAGAATAAATTAAATAATTAAAGAATTTAGAT
TAGGAAGATGAAGATGATTATGATGAAAATGGATCTAATTAAGATATTGATGAAGTCTAT
GCTGGAAATCCTAAAAATAAATCTTATTCATCAATTTAATCTAATAAATATTAAAACGAA
GATGATTAAACAGAAGCTGATCTTAGAAATCATAAAAAAAAGTTAGAGTTAGAAGCGAAA
GGAGGCAACCGTACTTCAACAAATTCTTTAGCTAGTAATTTAGAAAACTATAATAAAAGA
AAATATCTAAATTGGATTTAAACTTAACTCTAAGTAATACAAGAAAACGAATAAGCTAAA
ATAAAGTTGTCTCAATAAATTTTATAGTAATTTTTACCTACAAATACTTAATCTATTTGA


>TTHERM_00191480(protein)
MTQTELVPEDYDQDNQDASQSVISSGSVEDGKEKFKAMIHKILGVNDNKQIDKICCFSIF
NKQWSRTKQLFCVYSVFLTLFMTIILGCFVFYLKFCPNFVGDTILEQIDNSISASFQNSL
LEYSKQVHQYFKAYSSWMIMFSQIVANNVGWNNSLYQSSNELNLQPQQKYFPIYQPIPQN
IVNKQYSQKKPYYDKDISFQTFSYFHNHPDDATTISPATQTYLDSVDLISYFFSNFIQDP
NLTYVQSLYIYLQDRDVICFFPAGLIKVPKDFKIDMKQRPWYLNTAQTFQANGNKPVFTI
TSPYPDLTTKQITITYSLAIVKQSDPTQIAGVINVDVIVGNFRSVYDLLQEKDGEFQIAL
VDYNTEYIINDCFNQSGISHFYDTNNTNFTLENWNEIKDFNQHQQSQTFIITNSQNVRYY
FARTLIKDTVNQTLNRFYLIVFGKESNYLSYRNNIQDRIYNELYNFCISLIIAFSILWFF
SYFYIYALSRNIVLPLFKLSQLAKSINKHDERKSSAEDLKEQLGKIQGADTDTKKLIDSF
INLVDQHSGMRKLANGNGYQDNMIPVYNRMSNIYENYSRNDYREELDDIQEQIKQLKNLD
QEDEDDYDENGSNQDIDEVYAGNPKNKSYSSIQSNKYQNEDDQTEADLRNHKKKLELEAK
GGNRTSTNSLASNLENYNKRKYLNWIQTQLQVIQENEQAKIKLSQQILQQFLPTNTQSI


>TTHERM_00191480(gene)
ATGACACAAACGGAACTCGTTCCTGAAGATTATGACCAGGATAATTAAGATGCTTCTCAA
AGCGTAATCTCTTCAGGAAGCGTTGAAGATGGAAAAGAAAAATTTAAAGCAATGATACAT
AAAATTTTAGGAGTAAACGATAACAAATAAATAGATAAAATATGCTGTTTCTCCATTTTT
AATAAGCAGTGGTCTCGTACAAAGCAACTGTTTTGTGTTTACTCAGTCTTTTTGACATTA
TTTATGACTATAATATTAGGGTGTTTTGTGTTCTACTTAAAATTTTGTCCCAATTTCGTA
GGAGATACAATCTTAGAGTAGATTGATAACTCAATTTCTGCAAGCTTTTAAAATTCCTTA
CTTGAATACAGTAAATAAGTACATTAATATTTCAAAGCATATAGTTCTTGGATGATTATG
TTCTCCCAAATAGTAGCTAACAATGTTGGTTGGAATAATTCACTATATTAATCCTCAAAC
GAATTAAATTTATAACCACAACAAAAATATTTTCCTATTTATTAGCCTATCCCATAAAAT
ATAGTAAATAAGTAATATTCTTAGAAAAAGCCCTATTATGATAAAGATATATCATTTTAA
ACTTTTTCTTATTTTCACAACCATCCTGACGATGCAACTACTATTTCACCAGCTACTTAA
ACATATTTGGACTCTGTAGACTTGATTTCTTATTTTTTTTCTAATTTTATATAAGATCCT
AATTTAACTTATGTCTAGTCTTTATATATTTACCTTTAAGATCGAGATGTCATTTGTTTT
TTTCCAGCAGGCCTCATTAAAGTCCCAAAAGATTTTAAGATAGATATGAAATAAAGGCCT
TGGTATTTAAATACTGCTTAAACATTTTAAGCCAATGGAAATAAACCTGTATTTACAATT
ACCAGTCCCTATCCTGATTTAACTACTAAATAAATAACTATAACATACTCCCTTGCAATC
GTCAAACAGGTAATTCATAAATAAATCAATATTTCTATTATTTTTAATTTTGACAATTTA
AAATGCAAATAACTAAATAATAATATTTATTTATTTATTTATTTGCTTTTTGATTTTTCA
GTGGGTTAATTAATTTAAAATTTTTAATTAAAATAGTCAGATCCTACTTAAATTGCTGGA
GTTATTAATGTAGATGTTATTGTTGGTAATTTTAGATCTGTTTATGACTTGCTGCAGGAA
AAAGATGGTGAATTTTAAATTGCCTTAGTAGATTATAATACAGAATACATCATTAATGAT
TGCTTTAATTAAAGTGGAATTTCACATTTTTATGATACGAATAATACAAACTTTACACTT
GAAAATTGGAATGAAATCAAAGATTTTAATTAACACCAATAAAGTTAAACATTCATCATT
ACTAATAGTTAGAATGTAAGATATTATTTTGCTCGTACTTTAATAAAAGATACAGTAAAT
CAAACATTAAATAGATTTTATCTTATCGTCTTTGGTAAAGAAAGCAATTATCTCTCCTAT
AGAAACAATATTTAAGATAGAATATATAATGAGCTCTATAACTTTTGCATATCATTAATA
ATTGCTTTTTCTATTTTGTGGTTCTTTTCATATTTCTATATCTATGCTCTATCACGCAAT
ATTGTTCTACCGCTTTTTAAATTGAGTTAATTAGCTAAAAGTATAAACAAGCACGATGAG
AGAAAAAGCTCTGCTGAAGACTTGAAAGAATAGTTAGGTAAGATTTAAGGTGCAGATACT
GATACAAAAAAGCTTATCGATTCTTTCATTAACCTTGTAGATTAGCACTCTGGCATGAGA
AAACTAGCAAATGGTAATGGTTACTAAGACAATATGATCCCAGTCTACAATAGAATGAGC
AACATTTATGAAAACTATTCTAGGAATGACTACAGAGAAGAATTGGATGATATATAAGAA
TAAATTAAATAATTAAAGAATTTAGATTAGGAAGATGAAGATGATTATGATGAAAATGGA
TCTAATTAAGATATTGATGAAGTCTATGCTGGAAATCCTAAAAATAAATCTTATTCATCA
ATTTAATCTAATAAATATTAAAACGAAGATGATTAAACAGAAGCTGATCTTAGAAATCAT
AAAAAAAAGTTAGAGTTAGAAGCGAAAGGAGGCAACCGTACTTCAACAAATTCTTTAGCT
AGTAATTTAGAAAACTATAATAAAAGAAAATATCTAAATTGGATTTAAACTTAACTCTAA
GTAATACAAGAAAACGAATAAGCTAAAATAAAGTTGTCTCAATAAATTTTATAGTAATTT
TTACCTACAAATACTTAATCTATTTGA