Identifiers and Description

Gene Model Identifier

TTHERM_00191490

Standard Name

ASI1 (Anlagen Stage Induced 1 )

Aliases

PreTt08800 | 15.m00511 | 3697.m00222

Description

Zinc-finger protein of unknown function; developmentally regulated transcript induced during macronuclear anlagen stage; encodes a 95 kDa conceptual protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00191490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06167.19.997093137033517e-262anlagen stage induced 1 protei
n (808 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:12351190: Udani RA, Karrer KM (2002) ASI1, a gene encoding a novel leucine zipper protein, is induced during development of the macronucleus in Tetrahymena. Mechanisms of development 118(1-2):215-8

Sequences

>TTHERM_00191490(coding)
ATGCAAGATACCTTAGATGCTAAAAACAGCTATCTTAATTTTACTTTCTCTGAATCCAGG
ATTAAAGGAATTTCAAATATAAAAAATGCTAATCTGCTTAAAAATAATTAAGCTACAAGT
ATTATGGAATTAGATCAAACACTTCAAGCATTCCATAAAGCGTCACATGGTAATTTGAAG
AATATAATCAAGAATGCTGAAATATGCGCATTAGATCAATATAGTATCCAAAACAGATAA
TAAAATTTTGAAACTATAACATTAAATAAAAACAAATCTTAAAGTAGAGTTAGCAAAACT
GAAATTAGGAGTCTAAATCCACTTTCATGCAATGAATCTGAGAAAACAAAGTACTTTGAA
AATGAATAGGATAATTTATGTAATTTAGAAGATGAATACGAAAATGAGAGTAATTATCAT
AAAAATAATTTAGAGTCATAGTAAAGTAGCACACAGCTATTTGCAAATATTAGGCAAACT
AAGATATTTTAATAAATGAGAGACTATGTACGAACTCTAAAGAAGAATAAAATTATCTAA
AAATTTTGGTTTTGTTAAATAAATAGCAGATGGACTCGATAAAAGTAGCTTAATGTTTCA
TTCTTAATGATGAGTATTTGTATAATTAGTATTTTATTGATTTGCTGGGTTCTACTTTTA
TTCTTTATGTATCGTATTTTTGATGACACTTACTATCCAAATTACTCTGAAAGTGAAAAA
AATTAACTAATTTATACCTTATCCTCTTTACAAGAATCATTAGTTAGTCTCTTAAGAAGA
ACTGACCATCTTCACCAAGTCGCCATTAGCATTTATTAATCACAATAAAAAGGTCCCAAA
AACCCTTTTTACGATATTAATTTTGATTCTCATATATTAAAAGGAAAACAAAATTACATT
TCAATAAACTAAGATGTGTCACCTCAATTTAATGATACTTTAGGCTTTTACTTTTAAAAT
GTTGATACTCCAATTACATATGATTTTTTTTAATGGGCTACGTTTATAGACCAAAGAAAT
TACACTCATATTACACCAGAATCTTAGAAGATTCTTGATGACTTTGATATACTTAGTTAT
TTCATAAAAAACTTAATTGCTAATGCAAAATTTTCATTTTCTTACTCTTATTATTGTGGA
TTTGAAACAGATGAATTAGTTGTCTATTATCCAGCTGGTTTATAAAATGCTCTCAGAGGG
AAAGACAAGGTACCTGATTTTAGTTTTCACCCAAATTAGAGGGATTGGTACTCCTAAATA
ATTAAAAATAACCTATAGTATACAAATCAAACTTACTTTACTCTCCCCTATAAAGATTAA
ATAACTTAGCAATATATAATGACCATGTCTGTTGCTCTTCGTGATTAGGATGGAAAATTT
TAAGGTGTTTGTGCTACTGACTATTACTTAGATAAATTTGACAAATATATAAATTCAATA
GGCATAAATGAGTATTCTATTATGGCTCTGATAGATGCCAGTAACGATAATGGTATTATT
CTAACATAAAACAGTAGTATTATTAACTTTACTCCATAACAGTTCTTACAATTTTCTCCC
TCTTAATGGACAGATATGAAATAGCAAATACTTTAAACATTTAACAATAATACTAACAGC
TTAAATTCTTATAGCTATTTTTAAGACATTTAAGGATTTAAAGTTGCTGGTTCTGCTTTT
AAATCCAAAAATTCAAATGATCAAACCTTTATTTTATTAGTGAAGGAATCTACAAATTAG
TTCGAAAGACTTTACGATACAATAATTTAAAGAGTTTAAGATAAATATATTAAACCGAAT
ATTAACTTTATAATCGCATTTCTAGTGATAAGCTTTGCTCACATTATTTATTGCTTAATA
ATGAGTTATTATGTTACTCAACCTTATAGAAAAATAAAGTAGATATCTAACTAAATTACA
TAGAATTTAAAGGCATCAAATTAAATAGGATCACTTGATTCATACTTAAACACTTTAGAT
TTTAAAAGTGATAGAAATTTATATATTCTAGTCAAGTCTGCAAAAAAAATGGTTTTAAAA
ATATAAAAAGCCAGTACTAAGAAAATAATCGAAAATTAAAAATATTATCATGCTTATCAT
TATGAGTAAAATGAGTATTTTGATAGTCAAATGGAGTGGAGAGATGAAATAGAACAGCTG
GTAGATTATGGATTATCAAAAAACTTTAATTCACTCCCTACAAACCTAGAATTCTTCAAC
GATTGTGAATCAAAAATCACTGAGCTCAGAGATAACTCTCCCTTTGCTATTGTCAACAAT
AAATAAGAATCGCTAAAAATTAAATAAAAAATACTATCTGAAGATTCATTTTGCAAATCT
GTCTCTGTTCCATACATTGACTAAAAGTTCATGAACCACATCGAACAATATCTTCCCAAT
TTCTAAATGCCCTGA


>TTHERM_00191490(protein)
MQDTLDAKNSYLNFTFSESRIKGISNIKNANLLKNNQATSIMELDQTLQAFHKASHGNLK
NIIKNAEICALDQYSIQNRQQNFETITLNKNKSQSRVSKTEIRSLNPLSCNESEKTKYFE
NEQDNLCNLEDEYENESNYHKNNLESQQSSTQLFANIRQTKIFQQMRDYVRTLKKNKIIQ
KFWFCQINSRWTRQKQLNVSFLMMSICIISILLICWVLLLFFMYRIFDDTYYPNYSESEK
NQLIYTLSSLQESLVSLLRRTDHLHQVAISIYQSQQKGPKNPFYDINFDSHILKGKQNYI
SINQDVSPQFNDTLGFYFQNVDTPITYDFFQWATFIDQRNYTHITPESQKILDDFDILSY
FIKNLIANAKFSFSYSYYCGFETDELVVYYPAGLQNALRGKDKVPDFSFHPNQRDWYSQI
IKNNLQYTNQTYFTLPYKDQITQQYIMTMSVALRDQDGKFQGVCATDYYLDKFDKYINSI
GINEYSIMALIDASNDNGIILTQNSSIINFTPQQFLQFSPSQWTDMKQQILQTFNNNTNS
LNSYSYFQDIQGFKVAGSAFKSKNSNDQTFILLVKESTNQFERLYDTIIQRVQDKYIKPN
INFIIAFLVISFAHIIYCLIMSYYVTQPYRKIKQISNQITQNLKASNQIGSLDSYLNTLD
FKSDRNLYILVKSAKKMVLKIQKASTKKIIENQKYYHAYHYEQNEYFDSQMEWRDEIEQL
VDYGLSKNFNSLPTNLEFFNDCESKITELRDNSPFAIVNNKQESLKIKQKILSEDSFCKS
VSVPYIDQKFMNHIEQYLPNFQMP


>TTHERM_00191490(gene)
ATGCAAGATACCTTAGATGCTAAAAACAGCTATCTTAATTTTACTTTCTCTGAATCCAGG
ATTAAAGGAATTTCAAATATAAAAAATGCTAATCTGCTTAAAAATAATTAAGCTACAAGT
ATTATGGAATTAGATCAAACACTTCAAGCATTCCATAAAGCGTCACATGGTAATTTGAAG
AATATAATCAAGAATGCTGAAATATGCGCATTAGATCAATATAGTATCCAAAACAGATAA
TAAAATTTTGAAACTATAACATTAAATAAAAACAAATCTTAAAGTAGAGTTAGCAAAACT
GAAATTAGGAGTCTAAATCCACTTTCATGCAATGAATCTGAGAAAACAAAGTACTTTGAA
AATGAATAGGATAATTTATGTAATTTAGAAGATGAATACGAAAATGAGAGTAATTATCAT
AAAAATAATTTAGAGTCATAGTAAAGTAGCACACAGCTATTTGCAAATATTAGGCAAACT
AAGATATTTTAATAAATGAGAGACTATGTACGAACTCTAAAGAAGAATAAAATTATCTAA
AAATTTTGGTTTTGTTAAATAAATAGCAGATGGACTCGATAAAAGTAGCTTAATGTTTCA
TTCTTAATGATGAGTATTTGTATAATTAGTATTTTATTGATTTGCTGGGTTCTACTTTTA
TTCTTTATGTATCGTATTTTTGATGACACTTACTATCCAAATTACTCTGAAAGTGAAAAA
AATTAACTAATTTATACCTTATCCTCTTTACAAGAATCATTAGTTAGTCTCTTAAGAAGA
ACTGACCATCTTCACCAAGTCGCCATTAGCATTTATTAATCACAATAAAAAGGTCCCAAA
AACCCTTTTTACGATATTAATTTTGATTCTCATATATTAAAAGGAAAACAAAATTACATT
TCAATAAACTAAGATGTGTCACCTCAATTTAATGATACTTTAGGCTTTTACTTTTAAAAT
GTTGATACTCCAATTACATATGATTTTTTTTAATGGGCTACGTTTATAGACCAAAGAAAT
TACACTCATATTACACCAGAATCTTAGAAGATTCTTGATGACTTTGATATACTTAGTTAT
TTCATAAAAAACTTAATTGCTAATGCAAAATTTTCATTTTCTTACTCTTATTATTGTGGA
TTTGAAACAGATGAATTAGTTGTCTATTATCCAGCTGGTTTATAAAATGCTCTCAGAGGG
AAAGACAAGGTACCTGATTTTAGTTTTCACCCAAATTAGAGGGATTGGTACTCCTAAATA
ATTAAAAATAACCTATAGTATACAAATCAAACTTACTTTACTCTCCCCTATAAAGATTAA
ATAACTTAGCAATATATAATGACCATGTCTGTTGCTCTTCGTGATTAGGTAAAAGATCTA
TTTAATATTTTTTTATTTTTTGTCAATATTTTTTTGTAAAAAGATATTTCACCTGAATCA
GGTTAAAAAACCTTCTAATAAATATCCTGCAGAAACAATAAATTTAATTATTAAATCAAA
TTCTAAATTCTGAATTGATTTTTCTATCAATCAGAATCAAAAATTATTTATTACCAAATT
TCAAAACAAAAATAATAAATTAATTAATTTACTAGTGTAACATTGAACAATAAGTTATTT
ATTTATTTATTGATTTAATGAATGATAAAAAACAAAATATTCTTAAGCTTTTCCCTTAAG
ACAATTATTATTTAATTTTAAAAAGGATGGAAAATTTTAAGGTGTTTGTGCTACTGACTA
TTACTTAGATAAATTTGACAAATATATAAATTCAATAGGCATAAATGAGTATTCTATTAT
GGCTCTGATAGATGCCAGTAACGATAATGGTATTATTCTAACATAAAACAGTAGTATTAT
TAACTTTACTCCATAACAGTTCTTACAATTTTCTCCCTCTTAATGGACAGATATGAAATA
GCAAATACTTTAAACATTTAACAATAATACTAACAGCTTAAATTCTTATAGCTATTTTTA
AGACATTTAAGGATTTAAAGTTGCTGGTTCTGCTTTTAAATCCAAAAATTCAAATGATCA
AACCTTTATTTTATTAGTGAAGGAATCTACAAATTAGTTCGAAAGACTTTACGATACAAT
AATTTAAAGAGTTTAAGATAAATATATTAAACCGAATATTAACTTTATAATCGCATTTCT
AGTGATAAGCTTTGCTCACATTATTTATTGCTTAATAATGAGTTATTATGTTACTCAACC
TTATAGAAAAATAAAGTAGATATCTAACTAAATTACATAGAATTTAAAGGCATCAAATTA
AATAGGATCACTTGATTCATACTTAAACACTTTAGATTTTAAAAGTGATAGAAATTTATA
TATTCTAGTCAAGTCTGCAAAAAAAATGGTTTTAAAAATATAAAAAGCCAGTACTAAGAA
AATAATCGAAAATTAAAAATATTATCATGCTTATCATTATGAGTAAAATGAGTATTTTGA
TAGTCAAATGGAGTGGAGAGATGAAATAGAACAGCTGGTAGATTATGGATTATCAAAAAA
CTTTAATTCACTCCCTACAAACCTAGAATTCTTCAACGATTGTGAATCAAAAATCACTGA
GCTCAGAGATAACTCTCCCTTTGCTATTGTCAACAATAAATAAGAATCGCTAAAAATTAA
ATAAAAAATACTATCTGAAGATTCATTTTGCAAATCTGTCTCTGTTCCATACATTGACTA
AAAGTTCATGAACCACATCGAACAATATCTTCCCAATTTCTAAATGCCCTGA