Identifiers and Description

Gene Model Identifier

TTHERM_00442300

Standard Name

ASF1 (Anti-Silencing Factor)

Aliases

PreTt05630 | 50.m00199 | 3681.m00058

Description

Anti-silencing protein, ASF1-like containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF04729 ) Anti-silencing protein, ASF1-like

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00442300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12563.16.002196208547375e-166anti-silencing protein, ASF1-l
ike containing protein (251 aa
)
OxytrichaContig22786.0.g134.000820122464668e-47ASF1 like histone chaperone
DictyBaseDDB_G02855133.0009061039838537e-46asf1 on chromosome: 4 position
3334165 to 3335058
SGDYJL115W5.998886722426197e-42ASF1 Nucleosome assembly facto
r, involved in chromatin assem
bly and disassembly, anti-sile
ncing protein that causes dere
pression of silent loci when o
verexpressed; plays a role in
regulating Ty1 transposition
WormBaseWBGene000068172.00017271388466e-38locus:unc-85 Probable histon
e chaperone asf-1 status:Con
firmed UniProt:Q19326 prot
ein_id:CCD69205.1
Stentor CoeruleusSteCoe_158403.532628572200807e-24

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:24120531: Garg J, Lambert JP, Karsou A, Marquez S, Nabeel-Shah S, Bertucci V, Retnasothie DV, Radovani E, Pawson T, Gingras AC, Pearlman RE, Fillingham JS (2013) Conserved Asf1-importin ? physical interaction in growth and sexual development in the ciliate Tetrahymena thermophila. Journal of proteomics 94( ):311-26

Sequences

>TTHERM_00442300(coding)
ATGGCCTTAGTCAACATCTAAAACATCCAATTTCATAACAACCCTTGCCCTTTTTTGAGT
CCCTTTAAACTTGACGTAACCTTCGAATGTATCAAACCTATACCTGATGACATTGAATGG
TAATTAATTTATATTGGTTCTGCTAAAGATGAGAAATACGATTAAGTCCTTGATAAATTC
AGTATTGGGTCATTAGATTAAGGAGTGCTTTAATTTACCATTGAAACAAATCCACCTGAT
CACACTAAGATTCCAAACAAAGATGATTTACTTGGTGTAACTGCTATAATTCTAACTGTT
TCATACCACAATCAGGAGTTTTTCCGTGTTGGATACTATGTCTACAATCAATACAATGAT
CAGGAACTTATTATTAATGATCCTCCTTAAATTCTAATTGATAAGGTTGAGCGTAGTATC
CTTGATAAATAGCCTCGTATCACTCATTTCAACATAAAATGGGGTACTGAGGATGAAAAT
AAAGAAACTGACCCTAATACTTTAGCTATCCTCTAACAGTAATTAGCTTAAAATGGAACC
ATTCCTAATTAACTCATGCAAGAAATGCAATAAGTGAATAGCTAAATGCAATCTTTCTTA
CCTGATCCTTTTTCTAAGTCATCAGGAATACTCTAAGAGTTAACAACATAAGGATAGACT
AACAGCACAAATAGTTTCATGTTTGGTTAAGGGCTAGACATACCTTAAAATAATGCATTC
CAACCTACAAATGTATTCAGTTCTAATCCTTACTGA


>TTHERM_00442300(protein)
MALVNIQNIQFHNNPCPFLSPFKLDVTFECIKPIPDDIEWQLIYIGSAKDEKYDQVLDKF
SIGSLDQGVLQFTIETNPPDHTKIPNKDDLLGVTAIILTVSYHNQEFFRVGYYVYNQYND
QELIINDPPQILIDKVERSILDKQPRITHFNIKWGTEDENKETDPNTLAILQQQLAQNGT
IPNQLMQEMQQVNSQMQSFLPDPFSKSSGILQELTTQGQTNSTNSFMFGQGLDIPQNNAF
QPTNVFSSNPY


>TTHERM_00442300(gene)
AAAAAAAATTAAAAAAACAAATTTTAATAATTCAAGAAAAAGTAAGAAAAAAATCTTGCT
CATTTTCAGAAAGAAAAAAGGTTAGAAAAAGTTTATCTTCACACAAAGCTTCACAGCTCA
TCAAAGAACTCTATTTTTATTAATTTATAGGAAGCAACTTCGTTTCGCGTTAGAATAAAA
TAAATATTAAACAAGAAAAAAATCCAAAAAGTACGCATTTATCTACCTCAAATAAGCAAA
ATGGCCTTAGTCAACATCTAAAACATCCAATTTCATAACAACCCTTGCCCTTTTTTGAGT
CCCTTTAAACTTGACGTAACCTTCGAATGTATCAAACCTATACCTGATGACATTGAATGG
TAATTAATTTATATTGGTTCTGCTAAAGATGAGAAATACGATTAAGTCCTTGATAAATTC
AGTATTGGGTCATTAGATTAAGGAGTGCTTTAATTTACCATTGAAACAAATCCACCTGAT
CACACTAAGATTCCAAACAAAGATGATTTACTTGGTGTAACTGCTATAATTCTAACTGTT
TCATACCACAATCAGGAGTTTTTCCGTGTTGGATACTATGTCTACAATCAATACAATGAT
CAGGAACTTATTATTAATGATCCTCCTTAAATTCTAATTGATAAGGTTGAGCGTAGTATC
CTTGATAAATAGCCTCGTATCACTCATTTCAACATAAAATGGGGTACTGAGGATGAAAAT
AAAGAAACTGACCCTAATACTTTAGCTATCCTCTAACAGTAATTAGCTTAAAATGGAACC
ATTCCTAATTAACTCATGCAAGAAATGCAATAAGTGAATAGCTAAATGCAATCTTTCTTA
CCTGATCCTTTTTCTAAGTCATCAGGAATACTCTAAGAGTTAACAACATAAGGATAGACT
AACAGCACAAATAGTTTCATGTTTGGTTAAGGGCTAGACATACCTTAAAATAATGCATTC
CAACCTACAAATGTATTCAGTTCTAATCCTTACTGA