Identifiers and Description

Gene Model Identifier

TTHERM_00442300

Standard Name

ASF1 (Anti-Silencing Factor 1)

Aliases

PreTt05630 | 50.m00199 | 3681.m00058

Description

ASF1 histone chaperone asf1; Anti-silencing protein- ASF1-like containing protein; mediates nuclear transport of newly synthesized histones H3 and H4

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF04729 ) Anti-silencing protein, ASF1-like

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00442300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12563.16.002196208547375e-166anti-silencing protein, ASF1-l
ike containing protein (251 aa
)
OxytrichaContig22786.0.g134.000820122464668e-47ASF1 like histone chaperone
DictyBaseDDB_G02855133.0009061039838537e-46asf1 on chromosome: 4 position
3334165 to 3335058
SGDYJL115W5.998886722426197e-42ASF1 Nucleosome assembly facto
r, involved in chromatin assem
bly and disassembly, anti-sile
ncing protein that causes dere
pression of silent loci when o
verexpressed; plays a role in
regulating Ty1 transposition
WormBaseWBGene000068172.00017271388466e-38locus:unc-85 Probable histon
e chaperone asf-1 status:Con
firmed UniProt:Q19326 prot
ein_id:CCD69205.1
Stentor CoeruleusSteCoe_158403.532628572200807e-24

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):
  2. Ref:28621664: Akematsu T, Fukuda Y, Garg J, Fillingham JS, Pearlman RE, Loidl J (2017) Post-meiotic DNA double-strand breaks occur in Tetrahymena, and require Topoisomerase II and Spo11. eLife 6( ):
  3. Ref:24120531: Garg J, Lambert JP, Karsou A, Marquez S, Nabeel-Shah S, Bertucci V, Retnasothie DV, Radovani E, Pawson T, Gingras AC, Pearlman RE, Fillingham JS (2013) Conserved Asf1-importin ? physical interaction in growth and sexual development in the ciliate Tetrahymena thermophila. Journal of proteomics 94( ):311-26

Sequences

>TTHERM_00442300(coding)
ATGGCCTTAGTCAACATCTAAAACATCCAATTTCATAACAACCCTTGCCCTTTTTTGAGT
CCCTTTAAACTTGACGTAACCTTCGAATGTATCAAACCTATACCTGATGACATTGAATGG
TAATTAATTTATATTGGTTCTGCTAAAGATGAGAAATACGATTAAGTCCTTGATAAATTC
AGTATTGGGTCATTAGATTAAGGAGTGCTTTAATTTACCATTGAAACAAATCCACCTGAT
CACACTAAGATTCCAAACAAAGATGATTTACTTGGTGTAACTGCTATAATTCTAACTGTT
TCATACCACAATCAGGAGTTTTTCCGTGTTGGATACTATGTCTACAATCAATACAATGAT
CAGGAACTTATTATTAATGATCCTCCTTAAATTCTAATTGATAAGGTTGAGCGTAGTATC
CTTGATAAATAGCCTCGTATCACTCATTTCAACATAAAATGGGGTACTGAGGATGAAAAT
AAAGAAACTGACCCTAATACTTTAGCTATCCTCTAACAGTAATTAGCTTAAAATGGAACC
ATTCCTAATTAACTCATGCAAGAAATGCAATAAGTGAATAGCTAAATGCAATCTTTCTTA
CCTGATCCTTTTTCTAAGTCATCAGGAATACTCTAAGAGTTAACAACATAAGGATAGACT
AACAGCACAAATAGTTTCATGTTTGGTTAAGGGCTAGACATACCTTAAAATAATGCATTC
CAACCTACAAATGTATTCAGTTCTAATCCTTACTGA


>TTHERM_00442300(protein)
MALVNIQNIQFHNNPCPFLSPFKLDVTFECIKPIPDDIEWQLIYIGSAKDEKYDQVLDKF
SIGSLDQGVLQFTIETNPPDHTKIPNKDDLLGVTAIILTVSYHNQEFFRVGYYVYNQYND
QELIINDPPQILIDKVERSILDKQPRITHFNIKWGTEDENKETDPNTLAILQQQLAQNGT
IPNQLMQEMQQVNSQMQSFLPDPFSKSSGILQELTTQGQTNSTNSFMFGQGLDIPQNNAF
QPTNVFSSNPY


>TTHERM_00442300(gene)
ATGGCCTTAGTCAACATCTAAAACATCCAATTTCATAACAACCCTTGCCCTTTTTTGAGT
CCCTTTAAACTTGACGTAACCTTCGAATGTATCAAACCTATACCTGATGACATTGAATGG
TAATTAATTTATATTGGTTCTGCTAAAGATGAGAAATACGATTAAGTCCTTGATAAATTC
AGTATTGGGTCATTAGATTAAGGAGTGCTTTAATTTACCATTGAAACAAATCCACCTGAT
CACACTAAGATTCCAAACAAAGATGATTTACTTGGTGTAACTGCTATAATTCTAACTGTT
TCATACCACAATCAGGAGTTTTTCCGTGTTGGATACTATGTCTACAATCAATACAATGAT
CAGGAACTTATTATTAATGATCCTCCTTAAATTCTAATTGATAAGGTTGAGCGTAGTATC
CTTGATAAATAGCCTCGTATCACTCATTTCAACATAAAATGGGGTACTGAGGATGAAAAT
AAAGAAACTGACCCTAATACTTTAGCTATCCTCTAACAGTAATTAGCTTAAAATGGAACC
ATTCCTAATTAACTCATGCAAGAAATGCAATAAGTGAATAGCTAAATGCAATCTTTCTTA
CCTGATCCTTTTTCTAAGTCATCAGGAATACTCTAAGAGTTAACAACATAAGGATAGACT
AACAGCACAAATAGTTTCATGTTTGGTTAAGGGCTAGACATACCTTAAAATAATGCATTC
CAACCTACAAATGTATTCAGTTCTAATCCTTACTGA