Identifiers and Description

Gene Model Identifier

TTHERM_00221020

Standard Name

ART1 (Acyl-CoA Reductase/Transferase)

Aliases

PreTt22430 | 18.m00456 | 3701.m00213

Description

Fatty acyl-CoA reductase/dihydroxyacetone phosphate acyltransferase fusion gene; homolog of Drosophila male sterility protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01553 ) Acyltransferase
  • ( PF07993 ) NAD-binding domain 4
  • ( PF03015 ) Male sterility protein
  • ( TIGR01746 ) thioester reductase domain
  • ( PF02719 ) polysaccharide biosynthesis protein
  • ( PF01370 ) NAD dependent epimerase/dehydratase family
  • ( TIGR00530 ) 1-acylglycerol-3-phosphate O-acyltransferases
  • ( PF01073 ) 3-beta hydroxysteroid dehydrogenase/isomerase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00221020

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_29270
Tetrahymena borealisEI9_06784.19.997093137033517e-262male sterility protein (1141 a
a)
DictyBaseDDB_G02890819.997093137033517e-262DDB_G0289081 on chromosome: 5
position 2331738 to 2335669
OxytrichaContig15950.0.g649.997093137033517e-262Male sterility protein
WormBaseWBGene000222005.001742359316081e-68locus:fard-1 status:Partiall
y_confirmed UniProt:Q9TZL9
protein_id:CCD71597.1
SGDYBR115C0.0000029996948234116693LYS2 Alpha aminoadipate reduct
ase, catalyzes the reduction o
f alpha-aminoadipate to alpha-
aminoadipate 6-semialdehyde, w
hich is the fifth step in bios
ynthesis of lysine; activation
requires posttranslational ph
osphopantetheinylation by Lys5
p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00221020(coding)
ATGGGTAAGGTATTTTAGTTTTATGAAGGAAAGACCGTTTTATTGACTGGTATAACTGGC
TTTTTAGGAAAGGTCATTTTCGAAAAGTTTCTCAGAACCCTTCCTATGGTCAAGAGAATT
TACGTGTTGATTAGAAGCAAGAAAGGTAGTCCCGTTGAAGAGAGATTCAAAAAAGTTATC
CATGATTCTGAAATATTCGAAAGATTGAGATAAGAAAAGGGAGATAATTTTTTCAACTAT
CTTTTCAGCAAAGTTGTTCCTATTGAAGGTGATTTATTGAAGGAAGGATTAGGATTATCA
AAGCAAGATTATCAAACTATCACATAAGAAGCAAATATTGTTATTAATTGCGCTGCATCT
GTTGATTTTAATGCTAAATTAGAGGAAGCAATTAATATAAATGTAAGAGGTTCTCTAAGA
ATGATGGAATTATCAAAACAATGCCTTTAACTTGAAAATTTCGTCCACGTTTCTACTTGT
TATGTCAATAGTGATAAACGTGGCTGGATTGAAGAAGATATTTATAATACTGAATAAAAT
GCACGTTAATTGATGGATGATTTGATGAAAATGCCTCCTGCTGAATTAGAACGTTAGACC
AAAACAATTTTAGGCAATTACCCTAATACTTACGTTTTCACAAAAAGTGCAGTCGAGCGT
ATTATCAAGGCTGAACGTCCTCCAAACATGACCATAACTATAGTGCGTCCTTCTATTATC
GGAGCAGCTGTAAGCGAACCTTGTGTCGGATGGGTCGAAGGTGTAACTGCTGCCTCTGCT
GTCTTCTTACTTTCTGGTATTGGTATGCTTAAGTATATCCATGCTAATCGTAATGCTATT
GGTGATGTTGTTCCTGTTGATGTTGTTTCTGATTAAATTATAGTTACTGGTGCCTTATGC
GCTAATCTTAGAGATTTATCAGTATTTAATGCATCTACTTCAAGTAGAAATCCAATGCTT
TGGGAAGTTTCAGAAAGAAATACCGTCTAATATTGGAGAGCTAATCCTCCTGAGAAACGC
TTGGGTAGTTGCGAAGCTTAACTTATTAAAGATGAAAGACATCTCAGATTTAAGCAAATT
ATGCGTCGTATCCCAGCTCTAGCTTATCTTAAATTATCTAATTTCGTTGGCAGCGAAAAC
ATGAAGAAGAATGCTAACCGCTACTTGAAGATTATTTACAAAGCTGAATCAGTAAGCGCT
ACTTTTAGCCATTTCGCTTCAAATGAGTGGATTTTCGATAGCAGAAAAATCGAAAAAATG
ATTGATTAGTTGGATGAATAAGAAAAGAATGCTTTCTATTTGGATGTATCTGGTATTAAT
TGGGATAACTACATTTTAATGTTTAACTGGGGTATGCATAGATATGTCCTCAATGAAAAA
GTTGAACCTCCTGTTTCAGACAAAAATGATATTTTAAAAATTAACAATTAGGCAAAATAT
CCTTACTTCTCTGATATCAATTGGGCACTTAGCTCTGGAAAACCATTTAAGCCCCGTTCT
TATGAAGAGTATAAATCACTTTTATTTAATTCTTCAGCAGTTCAAGATGCTATCTCTTTA
GTCATCGAATAATAAACTAAAAAGCAAGGTTTTTCTTAAGGATTAGTTGAAAACGTAAAC
AAAGAAGCTCATGCTATCATTAAAGAAATGATTTCAAACTATAAAATGTCTACTTTGAGA
ATGATGGCATGGTTTTTACACAAAGTCTTTAAATAAATCTATGAAAAAGTAGTTATTGAC
GATGTCAATCTTAAGGCTCTTGCTAATCATAATGTTAAAAAAGATGGACCTCTTATTATG
ATTCCTACCCATAGATCCTATATTGATTTCCTCCTCGTTTCTTATATTTTCTTTGCATAT
AAAATGCAATGTCCTCATATTGCTGCTGCAGAAGATTTCTTGAATGTTACTGTTGTTCAT
CATATCCTCAGAGCCTGTGGTGCTTTCTTCACAAAACGTAATCAAAAAGAAAATCCTTTG
TACAAAGCTATTTTCTACGAATACGTATAAAGATTATTGATGGATGACTGTATGCTTGAA
TTCTTTGTTGAAGGAACAAGATCTAGAAGTGGTAAAATGCTCCATCCCAAGTTTGGAATA
ATGGGTATAGTAGCTGATGCTGTCTTCGACTCTAAAATTCCAGATGCTAAAATTGTTCCA
ATTACTTTGAATTATGATAAGGTCCTTGAAGGAGATACTTTCCCTTATGAATTATTAGGT
GAGGAAAAGGTCAAAGAATCCCTTCCTCGTTTAATTAAAGCTATTAAGACCCTTAGCATG
AATTTTGGAAGAATTCATGTAAATATTTGTGAACCAATGAGCATTAAATAATATTTAGCC
ACAAATTATCCTACAGCTGATTTAACTAATCGTGTTTAAAGAAAAAGTATTATTGAAGAC
CTTTCTTATAAAATTGAATATAAATTAACTGATGCTCTCGTCTGCATGCCTACAGGTATT
GTTTCAGCTATTATGCTCTAATCAAGAAAGGGTATTACTGAAGATAAACTTATAAATAAG
GTACACTGGGTTAGCTAAAGAATAGTTGAAAGAGGTGGTATCCTTGCCTTTACCCCAGAT
GTATCAGGATCTATGATTGCTACCAGATCATCTATGAATTTGCTTGAAGGTATTTTGCTT
AAGACAAAGAAGAATGTTTTTGAACTGGAAGTTACTTCAGATACCGAATATAAAAACGTC
TTAATGCTTTCATATTACCGTAATTAAATAGTTCATCTTTTTATATTAGAAGCTATTGTC
TGTGTTGCACTTACTGCTTTTGGACCTAACGTTGCTTTCAAGGAAGGAGTTTCACTTGAA
AGAATATGGGAAGAATCATCCTTCCTTATAGAACTTTTCGAGCGTGAATACGTTTTACCA
AACGTCCCTAAAACACTTGAACAATTCTCAAAAACTTTATTAGCAAAGATGATTGAATTA
AAGGTTTTAAAGGTTAACGAAAGTGGTAAGATTTGCATTGTTGATGAAAACCAAGTTTCT
TTCTATAACTCCCTCATTTATCCTCTTGTTGAGAGCTATTGGTCAGTCCTTTTGAATTTC
TACACATTATCTCAAAGCAAGACTAAATTTATGCCATTAAAGAAGTTCTTATAACAAGCT
TAATGGTTTACTGAAAATATGCACGATGAAAGAATTATCTAACATCATGAAAGCTGTTCT
CTTGACACAATTAAAAATGCTATTTAAAAATACAAACATTTCAAATTAATTCGTACATAT
ACTGATGCTGATAAATCTGGCGCAGAGGAGAACATTCTTCTCTTAGTAAACGAAGAAAAG
CTCAACGAACTTGAAACTCACATATAGAAATTCTTAAAGAAAGGATTCTCTTAAAGCGGA
TCAGTTAGTGATCTTGCTAAACGCACTTTACTTTCTGAGTATCCAATCTTAGCTAGATTA
TGA


>TTHERM_00221020(protein)
MGKVFQFYEGKTVLLTGITGFLGKVIFEKFLRTLPMVKRIYVLIRSKKGSPVEERFKKVI
HDSEIFERLRQEKGDNFFNYLFSKVVPIEGDLLKEGLGLSKQDYQTITQEANIVINCAAS
VDFNAKLEEAININVRGSLRMMELSKQCLQLENFVHVSTCYVNSDKRGWIEEDIYNTEQN
ARQLMDDLMKMPPAELERQTKTILGNYPNTYVFTKSAVERIIKAERPPNMTITIVRPSII
GAAVSEPCVGWVEGVTAASAVFLLSGIGMLKYIHANRNAIGDVVPVDVVSDQIIVTGALC
ANLRDLSVFNASTSSRNPMLWEVSERNTVQYWRANPPEKRLGSCEAQLIKDERHLRFKQI
MRRIPALAYLKLSNFVGSENMKKNANRYLKIIYKAESVSATFSHFASNEWIFDSRKIEKM
IDQLDEQEKNAFYLDVSGINWDNYILMFNWGMHRYVLNEKVEPPVSDKNDILKINNQAKY
PYFSDINWALSSGKPFKPRSYEEYKSLLFNSSAVQDAISLVIEQQTKKQGFSQGLVENVN
KEAHAIIKEMISNYKMSTLRMMAWFLHKVFKQIYEKVVIDDVNLKALANHNVKKDGPLIM
IPTHRSYIDFLLVSYIFFAYKMQCPHIAAAEDFLNVTVVHHILRACGAFFTKRNQKENPL
YKAIFYEYVQRLLMDDCMLEFFVEGTRSRSGKMLHPKFGIMGIVADAVFDSKIPDAKIVP
ITLNYDKVLEGDTFPYELLGEEKVKESLPRLIKAIKTLSMNFGRIHVNICEPMSIKQYLA
TNYPTADLTNRVQRKSIIEDLSYKIEYKLTDALVCMPTGIVSAIMLQSRKGITEDKLINK
VHWVSQRIVERGGILAFTPDVSGSMIATRSSMNLLEGILLKTKKNVFELEVTSDTEYKNV
LMLSYYRNQIVHLFILEAIVCVALTAFGPNVAFKEGVSLERIWEESSFLIELFEREYVLP
NVPKTLEQFSKTLLAKMIELKVLKVNESGKICIVDENQVSFYNSLIYPLVESYWSVLLNF
YTLSQSKTKFMPLKKFLQQAQWFTENMHDERIIQHHESCSLDTIKNAIQKYKHFKLIRTY
TDADKSGAEENILLLVNEEKLNELETHIQKFLKKGFSQSGSVSDLAKRTLLSEYPILARL


>TTHERM_00221020(gene)
ATGGGTAAGGTATTTTAGTTTTATGAAGGAAAGACCGTTTTATTGACTGGTATAACTGGC
TTTTTAGGAAAGGTCATTTTCGAAAAGTTTCTCAGAACCCTTCCTATGGTCAAGAGAATT
TACGTGTTGATTAGAAGCAAGAAAGGTAGTCCCGTTGAAGAGAGATTCAAAAAAGTTATC
CATGATTCTGAAATATTCGAAAGATTGAGATAAGAAAAGGGAGATAATTTTTTCAACTAT
CTTTTCAGCAAAGTTGTTCCTATTGAAGGTAAATAATTAAAACATCTTTTTTATTGCAAA
GGCTTTGATTATCACCATTTTTATAATCAACACTTATTGAAATTTAAGTTATTTTCTTCC
AAAAGCTCTTTGAAACTAACATTTTAATGAAACTAAAGCTTCTAAGTATATAAGATAACA
TTTACTATGTCGGATATTAAAATATTATTTAATATTTAAAAATATAGTAATAATATAATT
TTTACAATTTAAAAGAAATAAAGCTTGGATTCAATTGTTAAAGCATTAAAATTTTATACC
ATATTACCAATTCGCTTTTAACTAAATTTACTATTCAAATAGGTGATTTATTGAAGGAAG
GATTAGGATTATCAAAGCAAGATTATCAAACTATCACATAAGAAGCAAATATTGTTATTA
ATTGCGCTGCATCTGTTGATTTTAATGCTAAATTAGAGGAAGCAATTAATATAAATGTAA
GAGGTTCTCTAAGAATGATGGAATTATCAAAACAATGCCTTTAACTTGAAAATTTCGTCC
ACGTTTCTACTTGTTATGTCAATAGTGATAAACGTGGCTGGATTGAAGAAGATATTTATA
ATACTGAATAAAATGCACGTTAATTGATGGATGATTTGATGAAAATGCCTCCTGCTGAAT
TAGAACGTTAGACCAAAACAATTTTAGGCAATTACCCTAATACTTACGTTTTCACAAAAA
GTGCAGTCGAGCGTATTATCAAGGCTGAACGTCCTCCAAACATGACCATAACTATAGTGC
GTCCTTCTATTATCGGAGCAGCTGTAAGCGAACCTTGTGTCGGATGGGTCGAAGGTGTAA
CTGCTGCCTCTGCTGTCTTCTTACTTTCTGGTATTGGTATGCTTAAGTATATCCATGCTA
ATCGTAATGCTATTGGTGATGTTGTTCCTGTTGATGTTGTTTCTGATTAAATTATAGTTA
CTGGTGCCTTATGCGCTAATCTTAGAGATTTATCAGTATTTAATGCATCTACTTCAAGTA
GAAATCCAATGCTTTGGGAAGTTTCAGAAAGAAATACCGTCTAATATTGGAGAGCTAATC
CTCCTGAGAAACGCTTGGGTAGTTGCGAAGCTTAACTTATTAAAGATGAAAGACATCTCA
GATTTAAGCAAATTATGCGTCGTATCCCAGCTCTAGCTTATCTTAAATTATCTAATTTCG
TTGGCAGCGAAAACATGAAGAAGAATGCTAACCGCTACTTGAAGGTAATTAGATTAAATT
TTGATAATTTTACAAAGTGCAAATAAATTAAAAAATATTTATTTTTTTAAATTTAGTTTC
TAAATAGATATTTTTTAAATATTTATTATCAATTTGAAAAAGTAAAAAATAAATAAAAAA
AATAGCGCTTTTTATTTATTTCTTTTTAATTTACTTATTTACTTACTTACATCTCTAGTA
CTCATACTTTATACTTTGATTAATTTATTAAAAATTAGCTACTAAAAAAAGTTAATTAAT
TTATATAATTAAATAAAAATTAGATTATTTACAAAGCTGAATCAGTAAGCGCTACTTTTA
GCCATTTCGCTTCAAATGAGTGGATTTTCGATAGCAGAAAAATCGAAAAAATGATTGATT
AGTTGGATGAATAAGAAAAGAATGCTTTCTATTTGGATGTATCTGGTATTAATTGGGATA
ACTACATTTTAATGTTTAACTGGGGTATGCATAGATATGTCCTCAATGAAAAAGTTGAAC
CTCCTGTTTCAGACAAAAATGATATTTTAAAAATTAACAATTAGGCAAAATATCCTTACT
TCTCTGATATCAATTGGGCACTTAGCTCTGGAAAACCATTTAAGCCCCGTTCTTATGAAG
AGTATAAATCACTTTTATTTAATTCTTCAGCAGTTCAAGATGCTATCTCTTTAGTCATCG
AATAATAAACTAAAAAGCAAGGTTTTTCTTAAGGATTAGTTGAAAACGTAAACAAAGAAG
CTCATGCTATCATTAAAGAAATGATTTCAAACTATAAAATGTCTACTTTGAGAATGATGG
CATGGTTTTTACACAAAGTCTTTAAATAAATCTATGAAAAAGTAGTTATTGACGATGTCA
ATCTTAAGGCTCTTGCTAATCATAATGTTAAAAAAGATGGACCTCTTATTATGATTCCTA
CCCATAGATCCTATATTGATTTCCTCCTCGTTTCTTATATTTTCTTTGCATATAAAATGC
AATGTCCTCATATTGCTGCTGCAGAAGATTTCTTGAATGTTACTGTTGTTCATCATATCC
TCAGAGCCTGTGGTGCTTTCTTCACAAAACGTAATCAAAAAGAAAATCCTTTGTACAAAG
CTATTTTCTACGAATACGTATAAAGATTATTGATGGATGACTGTATGCTTGAATTCTTTG
TTGAAGGTTTCAATTATTATTATTAATAATATTTCAAATTTTAATTTAAAATTTTTTAAA
TTTAGGAACAAGATCTAGAAGTGGTAAAATGCTCCATCCCAAGTTTGGAATAATGGGTAT
AGTAGCTGATGCTGTCTTCGACTCTAAAATTCCAGATGCTAAAATTGTTCCAATTACTTT
GAATTATGATAAGGTCCTTGAAGGAGATACTTTCCCTTATGAATTATTAGGTGAGGAAAA
GGTCAAAGAATCCCTTCCTCGTTTAATTAAAGCTATTAAGACCCTTAGCATGAATTTTGG
AAGAATTCATGTAAATATTTGTGAACCAATGAGCATTAAATAATATTTAGCCACAAATTA
TCCTACAGCTGATTTAACTAATCGTGTTTAAAGAAAAAGTATTATTGAAGACCTTTCTTA
TAAAATTGAATATAAATTAACTGATGCTCTCGTCTGCATGCCTACAGGTATTGTTTCAGC
TATTATGCTCTAATCAAGAAAGGGTATTACTGAAGATAAACTTATAAATAAGGTACACTG
GGTTAGCTAAAGAATAGTTGAAAGAGGTGGTATCCTTGCCTTTACCCCAGATGTATCAGG
ATCTATGATTGCTACCAGATCATCTATGAATTTGCTTGAAGGTATTTTGCTTAAGACAAA
GAAGAATGTTTTTGAACTGGAAGTTACTTCAGATACCGAATATAAAAACGTCTTAATGCT
TTCATATTACCGTAATTAAATAGTTCATCTTTTTATATTAGAAGCTATTGTCTGTGTTGC
ACTTACTGCTTTTGGACCTAACGTTGCTTTCAAGGAAGGAGTTTCACTTGAAAGAATATG
GGAAGAATCATCCTTCCTTATAGAACTTTTCGAGCGTGAATACGTTTTACCAAACGTCCC
TAAAACACTTGAACAATTCTCAAAAACTTTATTAGCAAAGATGATTGAATTAAAGGTTTT
AAAGGTTAACGAAAGTGGTAAGATTTGCATTGTTGATGAAAACCAAGTTTCTTTCTATAA
CTCCCTCATTTATCCTCTTGTTGAGAGCTATTGGTCAGTCCTTTTGAATTTCTACACATT
ATCTCAAAGCAAGACTAAATTTATGCCATTAAAGAAGTTCTTATAACAAGCTTAATGGTT
TACTGAAAATATGCACGATGAAAGAATTATCTAACATCATGAAAGCTGTTCTCTTGACAC
AATTAAAAATGCTATTTAAAAATACAAACATTTCAAATTAATTCGTACATATACTGATGC
TGATAAATCTGGCGCAGAGGAGAACATTCTTCTCTTAGTAAACGAAGAAAAGCTCAACGA
ACTTGAAACTCACATATAGAAATTCTTAAAGAAAGGATTCTCTTAAAGCGGATCAGTTAG
TGATCTTGCTAAACGCACTTTACTTTCTGAGTATCCAATCTTAGCTAGATTATGA