Identifiers and Description

Gene Model Identifier

TTHERM_00221140

Standard Name

ARS2 (Alanyl-tRNA Synthetase 2)

Aliases

PreTt22442 | 18.m00468 | 3701.m00225

Description

Alanyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00221140

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_253700
Tetrahymena borealisEI9_06795.19.997093137033517e-262alanyl-tRNA synthetase (976 aa
)
OxytrichaContig17366.0.g589.997093137033517e-262tRNA synthetases class II (A)
SGDYOR335C7.998336109808381e-38ALA1 Cytoplasmic and mitochond
rial alanyl-tRNA synthetase, r
equired for protein synthesis;
point mutation (cdc64-1 allel
e) causes cell cycle arrest at
G1; lethality of null mutatio
n is functionally complemented
by human homolog
DictyBaseDDB_G02778231.9994920269952867e-34alaS on chromosome: 3 position
919657 to 922497
WormBaseWBGene000001974.000352986427571e-28locus:aars-2 Alanine--tRNA l
igase, cytoplasmic status:Co
nfirmed UniProt:O01541 pro
tein_id:CCD70212.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00221140(coding)
ATGGAAAATTTTGAAGAAAAGGTAGAAGAAGCCACATTAGTTGCTGCCAAGACTCCTAAG
GAAATGAAGGCTATGTACAGACCTGAATTCTAAAAGAACCCTTAAAAGTATTATCCCACT
TAAGTTTTTGCTAAGTTTGGCTACTCTAGACACCAATGTCCTAAATGCCAAAACTTTTAT
TGGAGATTCTCTGAAAAGCAAGATACTTGTGGTGACTCTGCTTGTGTTGGCAAGTACACT
TTTATTGGTGAACCCACTGGTATTGGTAAGGAAGAAAAGTTGACTTATGATGGAGCTTGG
AAGAACTTCGAAAAGTCTTTCACTTCTGCAAGAAAACCTTGCACAGCTATCAAGAGATAT
CCCGTTGTTGCAAGATGGAGAAATGATGTTGACTTTGTTGCTGCTGGTATCTACTGCTTC
TAACCCTACTGCATGACTGGTGAATTATAACCCCCTGCTAATCCTTTGATCCAACCTCAA
TTCTGCGTTAGATTCAATGATTTAGATAACATTGGATTAACTGGTAGACATTACAGTGGT
TTCATTATGATTGGTATTCAATCTTTCTGCTATCCTGGAACTGAAGATAAGACTTTCTTC
AGTGAAGAATGTGTTGAATTCAACTTGAACTGGCTTATTGATGGTCTTAAGATTCCTAAG
GATGAAATTACTCTCATTGAAGATATCTGGTCTGGCGGTGGTAACTTAGGTTCTTGCGTT
GAATACTTCGTTAAGGGTCTCGAAGTTGGTAACATGGTCTTCACCATGTATAAGTATTAC
CCCGATGGTAAGCTTGAAGATTTAGAAATTAAAGTTATTGATGTTGGTATTGGTATGGAA
AGAATTCCTTGGTTAATTAATGGTACTCCTACTTCATATATGGATGTTTTCGATACTTCC
TACAAATATCTTTAAGAAAAGTTATAAGTAGAAACAAGCACTGAAATTTGGAAGTAGATT
GGTCCTTACACTTGCCATCTTAATGCTGATGAATCAGATGATATGGAAAAAACATGGTAA
ATGGTTGCTTCCAGCATTGGAAAAACTGTCTAAGAATGCAAGCAAGCTATCACTCCTGTT
AAGGATCTCTACATTGTCCTCGATCACACTAGAGCTGCTTTAGTTCTCATTTAAGATGGT
GCTTTACCTTCAAATACTGGTGGTGGTTCAAATATCAGAAATATCATCAGAAGAGTATTT
GCTATCATGAAGAAAAATGGATGGTGGGATAAGTTAGGTAAAACAAAGGAAGAATAAATG
AAGAACTTCTTGACATTGTTCGACATGCATCAATAAGATTTAGAAAAACTTTATGGTAAG
TTCCCTGAATACAAATCTTTCGGAAGCATTATTGAAATTGAATATGAAAAGTGGAGCAGC
ACTGATAAGGCTCAACAAAAGAAGATTGTAGACTCTTTCAATAAGAAGAAAGCTCTTACT
CTTAATGATTGGATCGTAGCTATCGAATCTTGGGGTTTGTCTCCTGATACTATCACAGAA
GTTACTGGACTTCCTTAACCTGATAACCTATACAATGAAATGGAATTAAGAAAGATGAAA
TTAACTAAAGCTCCTGAACAAATTCTTTACTAAACTGCCAACATTTAAGAAACTGTTCAT
CTCTTCTATGAACACCAAAATAAATTTGATTTTGAAGCTAAAATAGTAGAAATTTTCGCT
GATTATAAGAACGTTGAAAACCGTAACATCGTAATCCTCGATTAATCATGTTTCTATCCC
ACATCTGGTGGTTAACAAAATGACATTGGTGTCATGACCGTCGACGGTTAAAAGTATAAT
GTTGTTGATGTTATTAAGGTTGGTAAATGTGTTCTTCACATTTTAGATAGATCCCTCCCT
AATCCTGATAATTCCCATTACATTGGATAAAAAGTTCATGCTGTTGTTGATGAAAACAGA
AGAAAAATTCTTCGTAATCATCACACTTCTACTCATATTGTTTTTGCTGCTTGCAGACAA
GTTTTAGGTCCTCATGTCTGGTAAAATGGTGCTAAGAAAACTGTTGATATGGCTCACTTG
GACATAACTCATTATGCATCATTGACTGAAGAATAAGAAATGGAAATCGAAAAAATTGCT
AACACTATCGTTTTCAGTAGCAAGAATATCAACAAAGAATTTGTTAATAAAGCTGAAGCT
GAAAAAGAACATGGTTTCCGTCTTTATTAAGGTGGTGTTGTACCAGGTGATACTTTGAGA
GTAGTCAATATTGAAGGAACTGATGTTGAAGCCTGTTGTGGTACTCACTGCGATAACACC
TCTGAAGTTGGTATTATTAGAATTTTAAAGACTAACAGAATTTCAGATGGTATTATCAGA
TTATACTTTGTTGCTGGTGAAAGATCTCTCCAAAAACTCTCAACTTAAACTAAGGTCCTT
GTTGATTTACAAAATATCTTCAAGGTAAAAGAATCAGATCTTGTCAGCACTTCCTTAAAG
TTCTTTACTGAAAGAAATAAATTCATTGAACGTCACAAATCTGCAACTTAAAAGGTTTTA
AATCTTCAAATGGAATTATTCCTTGCTAAGGATAAATACAAAAACATCTTTGTAAAGTCT
ACTGAATCTGAAGCAACATTATATTTCTCTTTCATGGGCAACTTTATTAAAGCTCAAAAG
GATGCTGGTAAAGGTATAGTTTTTGTTGGAGAAGGAGAAAAAGGTTTTGTCTTTGGTTAA
TTCGGTAATAAATCTGACTTTGATCAAGAAAAGTTCTTAGCTTTATTATAAGAAGATAAT
CCAGGAGTCACATATAAAAAATGCTTAACTTCAATCACTGCTAACAAAGTTAAACTTGAC
AACGTTTTACAATTCTCTTTCAGTGGCAAAGTTAAATATGAAAAAGTAAAGAAAGATTTA
ATTACTCTTGGTCTTATTGAAGCAGATCTCTGA


>TTHERM_00221140(protein)
MENFEEKVEEATLVAAKTPKEMKAMYRPEFQKNPQKYYPTQVFAKFGYSRHQCPKCQNFY
WRFSEKQDTCGDSACVGKYTFIGEPTGIGKEEKLTYDGAWKNFEKSFTSARKPCTAIKRY
PVVARWRNDVDFVAAGIYCFQPYCMTGELQPPANPLIQPQFCVRFNDLDNIGLTGRHYSG
FIMIGIQSFCYPGTEDKTFFSEECVEFNLNWLIDGLKIPKDEITLIEDIWSGGGNLGSCV
EYFVKGLEVGNMVFTMYKYYPDGKLEDLEIKVIDVGIGMERIPWLINGTPTSYMDVFDTS
YKYLQEKLQVETSTEIWKQIGPYTCHLNADESDDMEKTWQMVASSIGKTVQECKQAITPV
KDLYIVLDHTRAALVLIQDGALPSNTGGGSNIRNIIRRVFAIMKKNGWWDKLGKTKEEQM
KNFLTLFDMHQQDLEKLYGKFPEYKSFGSIIEIEYEKWSSTDKAQQKKIVDSFNKKKALT
LNDWIVAIESWGLSPDTITEVTGLPQPDNLYNEMELRKMKLTKAPEQILYQTANIQETVH
LFYEHQNKFDFEAKIVEIFADYKNVENRNIVILDQSCFYPTSGGQQNDIGVMTVDGQKYN
VVDVIKVGKCVLHILDRSLPNPDNSHYIGQKVHAVVDENRRKILRNHHTSTHIVFAACRQ
VLGPHVWQNGAKKTVDMAHLDITHYASLTEEQEMEIEKIANTIVFSSKNINKEFVNKAEA
EKEHGFRLYQGGVVPGDTLRVVNIEGTDVEACCGTHCDNTSEVGIIRILKTNRISDGIIR
LYFVAGERSLQKLSTQTKVLVDLQNIFKVKESDLVSTSLKFFTERNKFIERHKSATQKVL
NLQMELFLAKDKYKNIFVKSTESEATLYFSFMGNFIKAQKDAGKGIVFVGEGEKGFVFGQ
FGNKSDFDQEKFLALLQEDNPGVTYKKCLTSITANKVKLDNVLQFSFSGKVKYEKVKKDL
ITLGLIEADL


>TTHERM_00221140(gene)
ATGGAAAATTTTGAAGAAAAGGTAGAAGAAGCCACATTAGTTGCTGCCAAGACTCCTAAG
GTATCCTTACAGATTTATATATTTATGAGAGATTAAAAAGATTAAACTTTAATCAGCATT
TTTGCTAATTTATATTTCATTTAAAAATAGGAAATGAAGGCTATGTACAGACCTGAATTC
TAAAAGAACCCTTAAAAGTATTATCCCACTTAAGTTTTTGCTAAGTTTGGCTACTCTAGA
CACCAATGTCCTAAATGCCAAAACTTTTATTGGAGATTCTCTGAAAAGCAAGATACTTGT
GGTGACTCTGCGTAATATATTATTCTTACTTTAATTATTATCCAATAATACTAAAAAACT
CTTTTAAAATACATTTATATCGAGGTATCTCCATATTATTATTAAAATTCGACATGTATT
TTATTTAAGGGAGAGCTATTTAATTAAGAAATAAATAATATTTTATTAAATAAATTTAAA
ACTGAATAGTATATTTAACCGAAGAAATTTTAACAAAGTATCAATAAAATAGCATTAATT
GTAAATTCATTTTTATATAAATATAGTTGTGTTGGCAAGTACACTTTTATTGGTGAACCC
ACTGGTATTGGTAAGGAAGAAAAGTTGACTTATGATGGAGCTTGGAAGAACTTCGAAAAG
TCTTTCACTTCTGCAAGAAAACCTTGCACAGCTATCAAGAGATATCCCGTTGTTGCAAGA
TGGAGGTAAAATTTATATTTATAGCTATTTTTTTAAACTTAGACATAATCATGTTTTATT
AATTTTGCTTATTGAAAATGTTTTATAAGCTGTTTTTTGTTAAAAAAAATTTAAAAAACG
AATTTTTCGAAGTTGTTAATCAAAGTTGGAATTATTATAAAATCAAGAATTAAAGTTTGG
CGGAATTCTTTTAAAAGAAACAAACGATAATAATTTATGTCTTTGATTTGTGTCTTAAAT
ATTGATAGATTATACTTTTTGCTAACAATAAAAAATATCTTTTTGATTTTAGAATTTTAA
TTAATTTAAATTAAAAAACAAAAGAAATGATGTTGACTTTGTTGCTGCTGGTATCTACTG
CTTCTAACCCTACTGCATGACTGGTGAATTATAACCCCCTGCTAATCCTTTGATCCAACC
TCAATTCTGCGTTAGATTCAATGATTTAGATAACATTGGATTAACTGGTAGACATTACAG
TGGTTTCATTATGATTGGTATTCAATCTTTCTGCTATCCTGGAACTGAAGATAAGACTTT
CTTCAGTGAAGAATGTGTTGAATTCAACTTGAACTGGCTTATTGATGGTCTTAAGATTCC
TAAGGATGAAATTACTCTCATTGAAGATATCTGGTCTGGCGGTGGTAACTTAGGTTCTTG
CGTTGAATACTTCGTTAAGGGTCTCGAAGTTGGTAACATGGTCTTCACCATGTATAAGTA
TTACCCCGATGGTAACATTTAGCATTTTATAATAATCAATATTTTTTAAATAATTTTTAT
TTACCAAACAGGTAAGCTTGAAGATTTAGAAATTAAAGTTATTGATGTTGGTATTGGTAT
GGAAAGAATTCCTTGGTTAATTAATGGTACTCCTACTTCATATATGGATGTTTTCGATAC
TTCCTACAAATATCTTTAAGAAAAGTTATAAGTAGAAACAAGCACTGAAATTTGGAAGTA
GATTGGTCCTTACACTTGCCATCTTAATGCTGATGAATCAGATGATATGGAAAAAACATG
GTAAATGGTTGCTTCCAGCATTGGAAAAACTGTCTAAGAATGCAAGCAAGCTATCACTCC
TGTTAAGGATCTCTACATTGTCCTCGATCACACTAGAGCTGCTTTAGTTCTCATTTAAGA
TGGTGCTGTAACTAAACAAAAAAATCTATAATTTAAAAAATATAATAATTTTTTCATAAA
ATAAATAAATAAAGTTACCTTCAAATACTGGTGGTGGTTCAAATATCAGAAATATCATCA
GAAGAGTATTTGCTATCATGAAGAAAAATGGATGGTGGGATAAGTTAGGTAAAACAAAGG
AAGAATAAATGAAGAACTTCTTGACATTGTTCGACATGCATCAATAAGATTTAGAAAAAC
TTTATGGTAAGTTCCCTGAATACAAATCTTTCGGAAGCATTATTGAAATTGAATATGAAA
AGTGGAGCAGCACTGATAAGGCTCAACAAAAGAAGATTGTAGACTCTTTCAATAAGAAGA
AAGCTCTTACTCTTAATGATTGGATCGTAGCTATCGAATCTTGGGGTTTGTCTCCTGATA
CTATCACAGAAGTTACTGGACTTCCTTAACCTGATAACCTATACAATGAAATGGAATTAA
GAAAGATGAAATTAACTAAAGCTCCTGAACAAATTCTTTACTAAACTGCCAACATTTAAG
AAACTGTTCATCTCTTCTATGAACACCAAAATAAATTTGATTTTGAAGCTAAAATAGTAG
AAATTTTCGCTGATTATAAGAACGTTGAAAACCGTAACATCGTAATCCTCGATTAATCAT
GTTTCTATCCCACATCTGGTGGTTAACAAAATGACATTGGTGTCATGACCGTCGACGGTT
AAAAGTATAATGTTGTTGATGTTATTAAGGTTGGTAAATGTGTTCTTCACATTTTAGATA
GATCCCTCCCTAATCCTGATAATTCCCATTACATTGGATAAAAAGTTCATGCTGTTGTTG
ATGAAAACAGAAGAAAAATTCTTCGTAATCATCACACTTCTACTCATATTGTTTTTGCTG
CTTGCAGACAAGTACTTATTTATTTATTTCAATAATAAAATTGAATTCCATTAAATTCAA
ATATCTGAATAATTTTTTTTATTTAGGTTTTAGGTCCTCATGTCTGGTAAAATGGTGCTA
AGAAAACTGTTGATATGGCTCACTTGGACATAACTCATTATGCATCATTGACTGAAGAAT
AAGAAATGGAAATCGAAAAAATTGCTAACACTATCGTTTTCAGTAGCAAGAATATCAACA
AAGAATTTGTTAATAAAGCTGAAGCTGAAAAAGAACATGGTTTCCGTCTTTATTAAGGTG
GTGTTGTACCAGGTGATACTTTGAGAGTAGTCAATATTGAAGGAACTGATGTTGAAGCCT
GTTGTGGTACTCACTGCGATAACACCTCTGAAGTTGGTATTATTAGAATTTTAAAGACTA
ACAGAATTTCAGATGGTATTATCAGATTATACTTTGTTGCTGGTGAAAGATCTCTCCAAA
AACTCTCAACTTAAACTAAGGTCCTTGTTGATTTACAAAATATCTTCAAGGTAAAAGAAT
CAGATCTTGTCAGCACTTCCTTAAAGTTCTTTACTGAAAGAAATAAATTCATTGAACGTC
ACAAATCTGCAACTTAAAAGGTTTTAAATCTTCAAATGGAATTATTCCTTGCTAAGGATA
AATACAAAAACATCTTTGTAAAGTCTACTGAATCTGAAGCAACATTATATTTCTCTTTCA
TGGGCAACTTTATTAAAGCTCAAAAGGTAATAATTTTATTTTTTTTATATTATTTTAAAT
AAATAATATTAAAATCTATTTAGGATGCTGGTAAAGGTATAGTTTTTGTTGGAGAAGGAG
AAAAAGGTTTTGTCTTTGGTTAATTCGGTAATAAATCTGACTTTGATCAAGAAAAGTTCT
TAGCTTTATTATAAGAAGATAATCCAGGAGTCACATATAAAAAATGCTTAACTTCAATCA
CTGCTAACAAAGTTAAAGTAATTTTAAATAAATATATTTTAATACAATAAGTTTTATTTT
TTTATTTAACAAAAAAGCTTGACAACGTTTTACAATTCTCTTTCAGTGGCAAAGTTAAAT
ATGAAAAAGTAAAGAAAGATTTAATTACTCTTGGTCTTATTGAAGCAGATCTCTGA