Identifiers and Description

Gene Model Identifier

TTHERM_00473110

Standard Name

ARS1 (alanyl-tRNA synthetase 1)

Aliases

PreTt02211 | 57.m00150 | 3709.m00011

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07973 ) Threonyl and Alanyl tRNA synthetase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00473110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13092.15.997984985848154e-146hypothetical protein (282 aa)
OxytrichaContig20209.0.g501.0004249259458435e-52tRNA synthetases class II (A)
Stentor CoeruleusSteCoe_342756.47023492564546e-26
SGDYNL040W0.0000008998839737394744YNL040W Putative protein of un
known function with strong sim
ilarity to alanyl-tRNA synthas
es from Eubacteria; green fluo
rescent protein (GFP)-fusion p
rotein localizes to the cytopl
asm; YNL040W is not an essenti
al gene
WormBaseWBGene000001960.000030009396760408108locus:aars-1 Alanine--tRNA l
igase, mitochondrial status:
Confirmed UniProt:Q23122 p
rotein_id:CAA91396.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00473110(coding)
ATGGAAGTACTTAAATAAGAAAAAACTTATTTGCTCGACAGCTACTTATTTTCTTTGAAT
ACAAAGATCACCTAGGTAAAGCAAGACGAATCTGATCCTAATTTACTTAATATCTTATTT
GAAAAAACTATTTTCCATCCTTAAGGAGGCGGTCAACCTTCAGATAATGGATTTATTGAA
GTAAATGGTGAATAAATCCCTGTAAAAAAATTGATTTACATTAGAGAGCAAGAGCTTATT
TTCCATTAAGTAGAAAAAAAAGACTGTATCAAAGAGAATTAGGAAGTGAGAATGCAAATT
GATGAAAATTTCAGAAGATAAAACGTCTTGCTTCACTCTGGAGGTCACTTGATAGATGTT
GCTGTAAACAGATTAGGTTATGAATGGGAAGCTGGTAAAGGTTATCATTTTATTGATGGT
CCTTATGTTGAATACACTGTAAACAAATGGGAAGAAGGTAGCTAAGAAAAATTAAAGGAC
TAAATCAATTAAGAATTAGAAAAAATTTTGACAGAGGGTTCTCCTGAAAATCCATCTATA
TGTAAAATATACGAATATGATGAAGCCAAAAAAGAAATCAGTAATTTTCCTACTTATCTT
CCTGAAGGAATAAATATTAGATGGGTAAAACTTAATAAATTAGACCCTGGATGTCCATGT
GGTGGAACTCATGTAAAGAATGTGTCTGATTTTAAGAAAGTTGTTGTTAATAAAATCCAA
AAGAAAGGAAAAAAACTAAAAGTATCTTATACAGTTTAGTGA


>TTHERM_00473110(protein)
MEVLKQEKTYLLDSYLFSLNTKITQVKQDESDPNLLNILFEKTIFHPQGGGQPSDNGFIE
VNGEQIPVKKLIYIREQELIFHQVEKKDCIKENQEVRMQIDENFRRQNVLLHSGGHLIDV
AVNRLGYEWEAGKGYHFIDGPYVEYTVNKWEEGSQEKLKDQINQELEKILTEGSPENPSI
CKIYEYDEAKKEISNFPTYLPEGINIRWVKLNKLDPGCPCGGTHVKNVSDFKKVVVNKIQ
KKGKKLKVSYTVQ


>TTHERM_00473110(gene)
ATGGAAGTACTTAAATAAGAAAAAACTTATTTGCTCGACAGCTACTTATTTTCTTTGAAT
ACAAAGATCACCTAGGTAAAGCAAGACGAATCTGATCCTAATTTACTTAATATCTTATTT
GAAAAAACTATTTTCCATCCTTAAGGAGGCGGTCAACCTTCAGATAATGGATTTATTGAA
GTAAATGGTGAATAAATCCCTGTAAAAAAATTGATTTACATTAGAGAGCAAGAGCTTATT
TTCCATTAAGTAGAAAAAAAAGACTGTATCAAAGAGAATTAGGAAGTGAGAATGCAAATT
GATGAAAATTTCAGAAGATAAAACGTCTTGCTTCACTCTGGAGGTCACTTGATAGATGTT
GCTGTAAACAGATTAGGTTATGAATGGGAAGCTGGTAAAGGTTATCATTTTATTGATGGT
CCTTATGTTGAATACACTGTAAACAAATGGGAAGAAGGTAGCTAAGAAAAATTAAAGGAC
TAAATCAATTAAGAATTAGAAAAAATTTTGACAGAGGGTTCTCCTGAAAATCCATCTATA
TGTAAAATATACGAATATGATGAAGCCAAAAAAGAAATCAGTAATTTTCCTACTTATCTT
CCTGAAGGAATAAATATTAGATGGGTAAAACTTAATAAATTAGACCCTGGATGTCCATGT
GGTGGAACTCATGTAAAGAATGTGTCTGATTTTAAGAAAGTTGTTGTTAATAAAATCCAA
AAGAAAGGAAAAAAACTAAAAGTATCTTATACAGTTTAGTGA