Identifiers and Description

Gene Model Identifier

TTHERM_00311980

Standard Name

ARP8 (Actin-related protein 8)

Aliases

PreTt03387 | 30.m00196 | 3810.m01812

Description

actin-related protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00311980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03210.19.997093137033517e-262actin like protein (1004 aa)
OxytrichaContig7469.0.g373.9982663658145016e-63Actin
SGDYOR141C9.996273942859018e-26ARP8 Nuclear actin-related pro
tein involved in chromatin rem
odeling, component of chromati
n-remodeling enzyme complexes;
has mRNA binding activity
Stentor CoeruleusSteCoe_92844.248354255291589e-18
DictyBaseDDB_G02877796.997351175151406e-18arpG on chromosome: 5 position
683410 to 686250
WormBaseWBGene000183490.000019995566179747357status:Confirmed UniProt:Q20
329 protein_id:CCD63350.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00311980(coding)
ATGAATACTTAGCAAAGAATATCTGATTAGACAAAGGAATCTGTTTAAAATACTATTAGA
AATTTGCAATAACGTACTGAACATATTGAAAAGTTAATTGAAAAAGGTAATGATGTACTA
GTTTTCCAAATTGGCTCTCATAACATTAAATATGGGTTTGCAAGCTAAGAAAATCCTAAT
AAAATTCGTACATTAATTGCTTACAAAACAAAGAATAATGAATCTTCTTTCACTCATGAA
AGCTTTAGAACTTACGATGCATTTGATAAAGAAGTTAATAAATTGGAATAGCTATTAAAA
GGATAAAAAAAAATTGGAACTTAAACAAAAGGACCTAAAGGTGGATAAAACAGCGTTGCA
GCTTAAAAGCTCAAATAAAGAGTTGAAATCAGTTTAAAAACACTTGAATTTCAAAATAAG
ATGGAAATTGAAGAAAATGCTGAAAATGATATAACCAAGAGGACTATGTTGTTTGGCGAG
GAAGTTTTTATGGTAGAATAACATGATAATTTTATGATTCGTAAACCTATAAAGCACGGG
TATTTGAATGTAGGAGAGTACAACGGAGATTTTCATGGACCTATCAACGATATTTAAAAT
TTAATTGAATACATATTAATTAACAAGCTTAGTCTCACTCGTAAGTAATTCCCTTAATAC
AAAATAGTATTGTGTATACCTGATGTCTTTTAAAGGTAGCAAATTAAATTATTGGCAAAC
ATGTTTTTGCTTTCTTTAAATTTTAATGCTATTTACATGCACTAAGAAAGTATTCTAGCA
TGCTTTGGGTATTGCATTGGACAAGCTTGTGTTGTTGATATTGGTGCAGAAAAAATTAAT
GTTTGCTGTGTTGATGAAGGCTTGATAATTCCTAACACTTTAATGAGAAAAAATTATGGT
GGAGACGATATTGATGTTTCTTTAATGAGAATGCTAAATAAGAGAGGCTGCATAGCATTT
AAATAAAAGACTAACTACAGAGTCGAATGCAGAAATTATGGTGATATGCATTAAATTGAA
AAATTAAAAGAAAAACATGCCAGTTTTGAATAAGCTGAAGATCTTTCCAGTAGAGTTTTT
GAAATGCATTGTGTACGTAATGGAATTGAAGAGCTTTTTACAGTTTAGCACAATGAGGCT
TTATATATAGCACCCACTATTATTTTCCATGCTGATGTTTTAAATGCACTAACTAAAAAC
ACTTCAAACAGCTATAAAGACATAGATTTTGAATTCTATGACTATCGCTCAAAAAGATTT
GAGTACAATGAAGACCCTGAAGATAATTTGGAAGAAGTGACAGCTGGTATTGTTTGGGGA
CAATAAAAAAATCTGATTAACCCTTACTTAGCAGGAGCCCATATCATAGAACAGAGAAAA
AAAGATGAGCTGAAGAAAGAATTATTGGCTTAAAATCCTAATTTAAATTAATAGCAAAAT
TAAAATCCAGAATAAATTGAAGAGCAAAAGAAGCAAGAATTATAGCAACAACAAACCTAT
AAGCTTACTGAAGACGAATTGCTAAACCCTTACACTATGGTTAATTTAGAAGACATTATT
TCTCAATCTATTGCTAACGTGAAAGATCCCGAATTAAGAAAAAAATTAGCTAATCACATT
CTTATCATAGGAGGAACTAGTTAGACTTCTAAAATGGTGGAAGAATTAGAAGATAGATTA
ATAGAAAAAATATCCCAGTATGATTACAATATAGAACGTGTAGAAGTCATTGATTCATTG
TCTAAAAAAGAAATGTATCCTTCATATTTGAGTTGGATTGGAGCTACTGTTATACCTAGA
CTAGATTCTATTAAAGATTTATGGATAAACTAGAATAGATGGCTTGGTCTGTTTGATGAC
ATTGATGATTCCTCTGATGACGAAGTAAGCAATACTGAGGCTATGAGAAAAGAAGAGAGA
AAAGATAAATCCAATGAGTATGGTATTAAATATTTAAAGGAAAAAGTACCATTTTAATGG
TGA


>TTHERM_00311980(protein)
MNTQQRISDQTKESVQNTIRNLQQRTEHIEKLIEKGNDVLVFQIGSHNIKYGFASQENPN
KIRTLIAYKTKNNESSFTHESFRTYDAFDKEVNKLEQLLKGQKKIGTQTKGPKGGQNSVA
AQKLKQRVEISLKTLEFQNKMEIEENAENDITKRTMLFGEEVFMVEQHDNFMIRKPIKHG
YLNVGEYNGDFHGPINDIQNLIEYILINKLSLTRKQFPQYKIVLCIPDVFQRQQIKLLAN
MFLLSLNFNAIYMHQESILACFGYCIGQACVVDIGAEKINVCCVDEGLIIPNTLMRKNYG
GDDIDVSLMRMLNKRGCIAFKQKTNYRVECRNYGDMHQIEKLKEKHASFEQAEDLSSRVF
EMHCVRNGIEELFTVQHNEALYIAPTIIFHADVLNALTKNTSNSYKDIDFEFYDYRSKRF
EYNEDPEDNLEEVTAGIVWGQQKNLINPYLAGAHIIEQRKKDELKKELLAQNPNLNQQQN
QNPEQIEEQKKQELQQQQTYKLTEDELLNPYTMVNLEDIISQSIANVKDPELRKKLANHI
LIIGGTSQTSKMVEELEDRLIEKISQYDYNIERVEVIDSLSKKEMYPSYLSWIGATVIPR
LDSIKDLWINQNRWLGLFDDIDDSSDDEVSNTEAMRKEERKDKSNEYGIKYLKEKVPFQW


>TTHERM_00311980(gene)
ATGAATACTTAGCAAAGAATATCTGATTAGACAAAGGAATCTGTTTAAAATACTATTAGA
AATTTGCAATAACGTACTGAACATATTGAAAAGTTAATTGAAAAAGGTAATGATGTACTA
GTTTTCCAAATTGGCTCTCATAACATTAAATATGGGTTTGCAAGCTAAGAAAATCCTAAT
AAAATTCGTACATTAATTGCTTACAAAACAAAGAATAATGAATCTTCTTTCACTCATGAA
AGCTTTAGAACTTACGATGCATTTGATAAAGAAGTTAATAAATTGGAATAGCTATTAAAA
GGATAAAAAAAAATTGGAACTTAAACAAAAGGACCTAAAGGTGGATAAAACAGCGTTGCA
GCTTAAAAGCTCAAATAAAGAGTTGAAATCAGTTTAAAAACACTTGAATTTCAAAATAAG
ATGGAAATTGAAGAAAATGCTGAAAATGATATAACCAAGAGGACTATGTTGTTTGGCGAG
GAAGTTTTTATGGTAGAATAACATGATAATTTTATGATTCGTAAACCTATAAAGCACGGG
TATTTGAATGTAGGAGAGTACAACGGAGATTTTCATGGACCTATCAACGATATTTAAAAT
TTAATTGAATACATATTAATTAACAAGCTTAGTCTCACTCGTAAGTAATTCCCTTAATAC
AAAATAGTATTGTGTATACCTGATGTCTTTTAAAGGTAGCAAATTAAATTATTGGCAAAC
ATGTTTTTGCTTTCTTTAAATTTTAATGCTATTTACATGCACTAAGAAAGTATTCTAGCA
TGCTTTGGGTATTGCATTGGACAAGCTTGTGTTGTTGATATTGGTGCAGAAAAAATTAAT
GTTTGCTGTGTTGATGAAGGCTTGATAATTCCTAACACTTTAATGAGAAAAAATTATGGT
GGAGACGATATTGATGTTTCTTTAATGAGAATGCTAAATAAGAGAGGCTGCATAGCATTT
AAATAAAAGACTAACTACAGAGTCGAATGCAGAAATTATGGTGATATGCATTAAATTGAA
AAATTAAAAGAAAAACATGCCAGTTTTGAATAAGCTGAAGATCTTTCCAGTAGAGTTTTT
GAAATGCATTGTGTACGTAATGGAATTGAAGAGCTTTTTACAGTTTAGCACAATGAGGCT
TTATATATAGCACCCACTATTATTTTCCATGCTGATGTTTTAAATGCACTAACTAAAAAC
ACTTCAAACAGCTATAAAGACATAGATTTTGAATTCTATGACTATCGCTCAAAAAGATTT
GAGTACAATGAAGACCCTGAAGATAATTTGGAAGAAGTGACAGGTAAACAATTATTTGCA
TTTTATTCATTTTTTTGTAAAATTATGTTTTAAAAATAAATCAAAAATAAATAGCTGGTA
TTGTTTGGGGACAATAAAAAAATCTGATTAACCCTTACTTAGCAGGAGCCCATATCATAG
AACAGAGAAAAAAAGATGAGCTGAAGAAAGAATTATTGGCTTAAAATCCTAATTTAAATT
AATAGCAAAATTAAAATCCAGAATAAATTGAAGAGCAAAAGAAGCAAGAATTATAGCAAC
AACAAACCTATAAGCTTACTGAAGACGAATTGCTAAACCCTTACACTATGGTTAATTTAG
AAGACATTATTTCTCAATCTATTGCTAACGTGAAAGATCCCGAATTAAGAAAAAAATTAG
CTAATCACATTCTTATCATAGGTAAAACTAAAATTAATTTCATAGATAAATATTCTTACT
GTATATTAAAATTTATTAAATTCATTATTATTAAGTTTGTTTTAAGAAGATTTCTTAATT
TGTTTGTTTGTTTATTTATTTAATATTATTAATTAAGAAATTTTACAAATAAAAAATTAT
TTTTTTAAATTTAACAAATGAAATTATAATAATTTTATTTTAACAAAAAAAAGGAGGAAC
TAGTTAGACTTCTAAAATGGTGGAAGAATTAGAAGATAGATTAATAGAAAAAATATCCCA
GTATGATTACAATATAGAACGTGTAGAAGTCATTGATTCATTGTCTAAAAAAGAAATGTA
TCCTTCATATTTGAGTTGGATTGGAGCTACTGTTATACCTAGACTAGATTCTATTAAAGA
TTTATGGATAAACTAGAATAGATGGCTTGGTCTGTTTGATGACATTGATGATTCCTCTGA
TGACGAAGTAAGCAATACTGAGGCTATGAGAAAAGAAGAGAGAAAAGATAAATCCAATGA
GTATGGTATTAAATATTTAAAGGAAAAAGTACCATTTTAATGGTGA