Identifiers and Description

Gene Model Identifier

TTHERM_00311980

Standard Name

ARP8 (Actin-Related Protein 8)

Aliases

PreTt03387 | 30.m00196 | 3810.m01812

Description

ARP8 actin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00311980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03210.19.997093137033517e-262actin like protein (1004 aa)
OxytrichaContig7469.0.g373.9982663658145016e-63Actin
SGDYOR141C9.996273942859018e-26ARP8 Nuclear actin-related pro
tein involved in chromatin rem
odeling, component of chromati
n-remodeling enzyme complexes;
has mRNA binding activity
Stentor CoeruleusSteCoe_92844.248354255291589e-18
DictyBaseDDB_G02877796.997351175151406e-18arpG on chromosome: 5 position
683410 to 686250
WormBaseWBGene000183490.000019995566179747357status:Confirmed UniProt:Q20
329 protein_id:CCD63350.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00311980(coding)
ATGAATACTTAGCAAAGAATATCTGATTAGACAAAGGAATCTGTTTAAAATACTATTAGA
AATTTGCAATAACGTACTGAACATATTGAAAAGTTAATTGAAAAAGGTAATGATGTACTA
GTTTTCCAAATTGGCTCTCATAACATTAAATATGGGTTTGCAAGCTAAGAAAATCCTAAT
AAAATTCGTACATTAATTGCTTACAAAACAAAGAATAATGAATCTTCTTTCACTCATGAA
AGCTTTAGAACTTACGATGCATTTGATAAAGAAGTTAATAAATTGGAATAGCTATTAAAA
GGATAAAAAAAAATTGGAACTTAAACAAAAGGACCTAAAGGTGGATAAAACAGCGTTGCA
GCTTAAAAGCTCAAATAAAGAGTTGAAATCAGTTTAAAAACACTTGAATTTCAAAATAAG
ATGGAAATTGAAGAAAATGCTGAAAATGATATAACCAAGAGGACTATGTTGTTTGGCGAG
GAAGTTTTTATGGTAGAATAACATGATAATTTTATGATTCGTAAACCTATAAAGCACGGG
TATTTGAATGTAGGAGAGTACAACGGAGATTTTCATGGACCTATCAACGATATTTAAAAT
TTAATTGAATACATATTAATTAACAAGCTTAGTCTCACTCGTAAGTAATTCCCTTAATAC
AAAATAGTATTGTGTATACCTGATGTCTTTTAAAGGTAGCAAATTAAATTATTGGCAAAC
ATGTTTTTGCTTTCTTTAAATTTTAATGCTATTTACATGCACTAAGAAAGTATTCTAGCA
TGCTTTGGGTATTGCATTGGACAAGCTTGTGTTGTTGATATTGGTGCAGAAAAAATTAAT
GTTTGCTGTGTTGATGAAGGCTTGATAATTCCTAACACTTTAATGAGAAAAAATTATGGT
GGAGACGATATTGATGTTTCTTTAATGAGAATGCTAAATAAGAGAGGCTGCATAGCATTT
AAATAAAAGACTAACTACAGAGTCGAATGCAGAAATTATGGTGATATGCATTAAATTGAA
AAATTAAAAGAAAAACATGCCAGTTTTGAATAAGCTGAAGATCTTTCCAGTAGAGTTTTT
GAAATGCATTGTGTACGTAATGGAATTGAAGAGCTTTTTACAGTTTAGCACAATGAGGCT
TTATATATAGCACCCACTATTATTTTCCATGCTGATGTTTTAAATGCACTAACTAAAAAC
ACTTCAAACAGCTATAAAGACATAGATTTTGAATTCTATGACTATCGCTCAAAAAGATTT
GAGTACAATGAAGACCCTGAAGATAATTTGGAAGAAGTGACAGCTGGTATTGTTTGGGGA
CAATAAAAAAATCTGATTAACCCTTACTTAGCAGGAGCCCATATCATAGAACAGAGAAAA
AAAGATGAGCTGAAGAAAGAATTATTGGCTTAAAATCCTAATTTAAATTAATAGCAAAAT
TAAAATCCAGAATAAATTGAAGAGCAAAAGAAGCAAGAATTATAGCAACAACAAACCTAT
AAGCTTACTGAAGACGAATTGCTAAACCCTTACACTATGGTTAATTTAGAAGACATTATT
TCTCAATCTATTGCTAACGTGAAAGATCCCGAATTAAGAAAAAAATTAGCTAATCACATT
CTTATCATAGGAGGAACTAGTTAGACTTCTAAAATGGTGGAAGAATTAGAAGATAGATTA
ATAGAAAAAATATCCCAGTATGATTACAATATAGAACGTGTAGAAGTCATTGATTCATTG
TCTAAAAAAGAAATGTATCCTTCATATTTGAGTTGGATTGGAGCTACTGTTATACCTAGA
CTAGATTCTATTAAAGATTTATGGATAAACTAGAATAGATGGCTTGGTCTGTTTGATGAC
ATTGATGATTCCTCTGATGACGAAGTAAGCAATACTGAGGCTATGAGAAAAGAAGAGAGA
AAAGATAAATCCAATGAGTATGGTATTAAATATTTAAAGGAAAAAGTACCATTTTAATGG
TGA


>TTHERM_00311980(protein)
MNTQQRISDQTKESVQNTIRNLQQRTEHIEKLIEKGNDVLVFQIGSHNIKYGFASQENPN
KIRTLIAYKTKNNESSFTHESFRTYDAFDKEVNKLEQLLKGQKKIGTQTKGPKGGQNSVA
AQKLKQRVEISLKTLEFQNKMEIEENAENDITKRTMLFGEEVFMVEQHDNFMIRKPIKHG
YLNVGEYNGDFHGPINDIQNLIEYILINKLSLTRKQFPQYKIVLCIPDVFQRQQIKLLAN
MFLLSLNFNAIYMHQESILACFGYCIGQACVVDIGAEKINVCCVDEGLIIPNTLMRKNYG
GDDIDVSLMRMLNKRGCIAFKQKTNYRVECRNYGDMHQIEKLKEKHASFEQAEDLSSRVF
EMHCVRNGIEELFTVQHNEALYIAPTIIFHADVLNALTKNTSNSYKDIDFEFYDYRSKRF
EYNEDPEDNLEEVTAGIVWGQQKNLINPYLAGAHIIEQRKKDELKKELLAQNPNLNQQQN
QNPEQIEEQKKQELQQQQTYKLTEDELLNPYTMVNLEDIISQSIANVKDPELRKKLANHI
LIIGGTSQTSKMVEELEDRLIEKISQYDYNIERVEVIDSLSKKEMYPSYLSWIGATVIPR
LDSIKDLWINQNRWLGLFDDIDDSSDDEVSNTEAMRKEERKDKSNEYGIKYLKEKVPFQW


>TTHERM_00311980(gene)
ATGAATACTTAGCAAAGAATATCTGATTAGACAAAGGAATCTGTTTAAAATACTATTAGA
AATTTGCAATAACGTACTGAACATATTGAAAAGTTAATTGAAAAAGGTAATGATGTACTA
GTTTTCCAAATTGGCTCTCATAACATTAAATATGGGTTTGCAAGCTAAGAAAATCCTAAT
AAAATTCGTACATTAATTGCTTACAAAACAAAGAATAATGAATCTTCTTTCACTCATGAA
AGCTTTAGAACTTACGATGCATTTGATAAAGAAGTTAATAAATTGGAATAGCTATTAAAA
GGATAAAAAAAAATTGGAACTTAAACAAAAGGACCTAAAGGTGGATAAAACAGCGTTGCA
GCTTAAAAGCTCAAATAAAGAGTTGAAATCAGTTTAAAAACACTTGAATTTCAAAATAAG
ATGGAAATTGAAGAAAATGCTGAAAATGATATAACCAAGAGGACTATGTTGTTTGGCGAG
GAAGTTTTTATGGTAGAATAACATGATAATTTTATGATTCGTAAACCTATAAAGCACGGG
TATTTGAATGTAGGAGAGTACAACGGAGATTTTCATGGACCTATCAACGATATTTAAAAT
TTAATTGAATACATATTAATTAACAAGCTTAGTCTCACTCGTAAGTAATTCCCTTAATAC
AAAATAGTATTGTGTATACCTGATGTCTTTTAAAGGTAGCAAATTAAATTATTGGCAAAC
ATGTTTTTGCTTTCTTTAAATTTTAATGCTATTTACATGCACTAAGAAAGTATTCTAGCA
TGCTTTGGGTATTGCATTGGACAAGCTTGTGTTGTTGATATTGGTGCAGAAAAAATTAAT
GTTTGCTGTGTTGATGAAGGCTTGATAATTCCTAACACTTTAATGAGAAAAAATTATGGT
GGAGACGATATTGATGTTTCTTTAATGAGAATGCTAAATAAGAGAGGCTGCATAGCATTT
AAATAAAAGACTAACTACAGAGTCGAATGCAGAAATTATGGTGATATGCATTAAATTGAA
AAATTAAAAGAAAAACATGCCAGTTTTGAATAAGCTGAAGATCTTTCCAGTAGAGTTTTT
GAAATGCATTGTGTACGTAATGGAATTGAAGAGCTTTTTACAGTTTAGCACAATGAGGCT
TTATATATAGCACCCACTATTATTTTCCATGCTGATGTTTTAAATGCACTAACTAAAAAC
ACTTCAAACAGCTATAAAGACATAGATTTTGAATTCTATGACTATCGCTCAAAAAGATTT
GAGTACAATGAAGACCCTGAAGATAATTTGGAAGAAGTGACAGGTAAACAATTATTTGCA
TTTTATTCATTTTTTTGTAAAATTATGTTTTAAAAATAAATCAAAAATAAATAGCTGGTA
TTGTTTGGGGACAATAAAAAAATCTGATTAACCCTTACTTAGCAGGAGCCCATATCATAG
AACAGAGAAAAAAAGATGAGCTGAAGAAAGAATTATTGGCTTAAAATCCTAATTTAAATT
AATAGCAAAATTAAAATCCAGAATAAATTGAAGAGCAAAAGAAGCAAGAATTATAGCAAC
AACAAACCTATAAGCTTACTGAAGACGAATTGCTAAACCCTTACACTATGGTTAATTTAG
AAGACATTATTTCTCAATCTATTGCTAACGTGAAAGATCCCGAATTAAGAAAAAAATTAG
CTAATCACATTCTTATCATAGGTAAAACTAAAATTAATTTCATAGATAAATATTCTTACT
GTATATTAAAATTTATTAAATTCATTATTATTAAGTTTGTTTTAAGAAGATTTCTTAATT
TGTTTGTTTGTTTATTTATTTAATATTATTAATTAAGAAATTTTACAAATAAAAAATTAT
TTTTTTAAATTTAACAAATGAAATTATAATAATTTTATTTTAACAAAAAAAAGGAGGAAC
TAGTTAGACTTCTAAAATGGTGGAAGAATTAGAAGATAGATTAATAGAAAAAATATCCCA
GTATGATTACAATATAGAACGTGTAGAAGTCATTGATTCATTGTCTAAAAAAGAAATGTA
TCCTTCATATTTGAGTTGGATTGGAGCTACTGTTATACCTAGACTAGATTCTATTAAAGA
TTTATGGATAAACTAGAATAGATGGCTTGGTCTGTTTGATGACATTGATGATTCCTCTGA
TGACGAAGTAAGCAATACTGAGGCTATGAGAAAAGAAGAGAGAAAAGATAAATCCAATGA
GTATGGTATTAAATATTTAAAGGAAAAAGTACCATTTTAATGGTGA