Identifiers and Description

Gene Model Identifier

TTHERM_01005190

Standard Name

ARP6 (Actin-Related Protein 6)

Aliases

PreTt27636 | 192.m00074 | 3757.m00322

Description

Actin family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12%

TetraMine Data

TTHERM_01005190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19894.19.997093137033517e-262actin family protein (401 aa)
OxytrichaContig9419.0.g211.9999590304423412e-72Actin
WormBaseWBGene000074347.001890014428386e-55locus:arp-6 Actin-like prote
in C08B11.6 status:Confirmed
UniProt:Q09443 protein_id
:CAA86667.3
SGDYFL039C4.997755005759707e-41ACT1 Actin, structural protein
involved in cell polarization
, endocytosis, and other cytos
keletal functions
DictyBaseDDB_G02741317.003455847728069e-40act17 on chromosome: 2 positio
n 4723516 to 4724640
Stentor CoeruleusSteCoe_221922.1151310375910805e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01005190(coding)
ATGAGCGATTGGAAGACAAATTTAAATAAAAGATTAATAGTGGATAATGGTTCTTGGGAA
ATAAGATTAGGATCTGCTTTAAATGAAGTACCTAATTTAACTTACTATAATTTATTAGGT
ATTGACAGAAAAAATGGTAATTTGTTATGCGGAGAGAATTTAAATAACTACATAGATGAA
GCTAATTTGATATATGTAAAGCCTTAAGTAAGGGGTGTTGTAGTTGATTGGGATCATGAA
GTTCATTTATGGGAAAAAATGCTAGATGCTTAAACAGAATTTGAATCAAAATAAAACGAG
TTATAATCTTATAGTATTAGTATATTGCACAACCCTTGCGTACCTGATAAAGTTAGATAA
AGAATGATTGAAGTTTGTTTTGAGTATTTTGGATTTGATGCAATATATCCTGCTTTATCT
CAACAAATGTCTCAAATACACGCTTTAGATAAATACAATAAAAAAATAAGCGACACTTTT
CAGTTAGTTATAGAAATAGGGCACTCTGCTACTTACTTTGTGCCTTTCTTTGATGGATAA
CCTATAAATTATGCAATTAAAAGATTAGATGTTGGTGGTAAATTACTTACAAACCATTTG
AAAGAAATTATTACATGCAGATATATTCAGCTAAAAAACGAAATTAGAATGGTTTCTCAA
ATTAAAGAGGACATGTGTTTTGTGTCACAAAATTTTTAAAAAGATATCAAATTGCGAAAA
GGCTCTCATACCAAGTATTTTATTTTACCTGATTACGAGACAGGTAAAAAAGGTTTTGCT
GTAGATTTCTATGATAGATCTTCTTATAGTGATAAGCTAACTTTAGACAAAGAGAGATTC
ACCCTTCCAGAAATATTGTTTAATCCAAGTGATATAGGTTTAGATTAATGTGGTATCTCA
TAAGGCGCAAGCAGTGTTATTAAGGAAATACATCCTGATATTAAAGAATACTTCTATGAG
AATATCATTTTATGTGGTGGATCATCAAATTTTGTGGGCTTAAAAGAAAGACTATTAAAT
GAAGTCACTTAGAATACTCCTGATTATTTAGATAATAAATTAGTTCATCTCAAAGACACT
TCATCAGCTTATTAGGGATGTTAAAGGGTAACTTCAGGAGATAATTTTGAAATGCTAGCT
ATGAATAGAAATGATTATAAAGAATATGGATTTGAACAACTAAATGCTCTGTATTTTATT
TGA


>TTHERM_01005190(protein)
MSDWKTNLNKRLIVDNGSWEIRLGSALNEVPNLTYYNLLGIDRKNGNLLCGENLNNYIDE
ANLIYVKPQVRGVVVDWDHEVHLWEKMLDAQTEFESKQNELQSYSISILHNPCVPDKVRQ
RMIEVCFEYFGFDAIYPALSQQMSQIHALDKYNKKISDTFQLVIEIGHSATYFVPFFDGQ
PINYAIKRLDVGGKLLTNHLKEIITCRYIQLKNEIRMVSQIKEDMCFVSQNFQKDIKLRK
GSHTKYFILPDYETGKKGFAVDFYDRSSYSDKLTLDKERFTLPEILFNPSDIGLDQCGIS
QGASSVIKEIHPDIKEYFYENIILCGGSSNFVGLKERLLNEVTQNTPDYLDNKLVHLKDT
SSAYQGCQRVTSGDNFEMLAMNRNDYKEYGFEQLNALYFI


>TTHERM_01005190(gene)
ATGAGCGATTGGAAGACAAATTTAAATAAAAGATTAATAGTGGATAATGGTTCTTGGGAA
ATAAGATTAGGATCTGCTTTAAATGAAGTACCTAATTTAACTTACTATAATTTATTAGGT
AAATTTAAATGAGAGAAAGTTTGATCAGTTTTTTAGCTTATAATATTTGTTAGGTATTGA
CAGAAAAAATGGTAATTTGTTATGCGGAGAGAATTTAAATAACTACATAGATGAAGCTAA
TTTGATATATGTAAAGCCTTAAGTAAGGGGTGTTGTAGTTGATTGGGATCATGAAGTTCA
TTTATGGGAAAAAATGTCATTATTTATTTTCAATCAGAATAAATGAAAAATTGAAATAAT
TTTTAAAAAACAGGCTAGATGCTTAAACAGAATTTGAATCAAAATAAAACGAGTTATAAT
CTTATAGTATTAGTATATTGCACAACCCTTGCGTACCTGATAAAGTTAGATAAAGAATGA
TTGAAGTTTGTTTTGAGTATTTTGGATTTGATGCAATATATCCTGCTTTATCTCAACAAA
TGTCTCAAATACACGCTTTAGATAAATACAATAAAAAAATAAGCGACACTTTTCAGTTAG
TTATAGAAATAGGGCACTCTGCTACTTACTTTGTGCCTTTCTTTGATGGATAACCTATAA
ATTATGCAATTAAAAGATTAGATGTTGGTAATAATAAATAAAATATTAATTATTAAGATA
TTTATTTAAATATTAATTAATTCCAATATTTAATTAGAATATTTATAATTTAATTATAAA
ATATTTTTTATAGGTGGTAAATTACTTACAAACCATTTGAAAGAAATTATTACATGCAGA
TATATTCAGCTAAAAAACGAAATTAGAATGGTTTCTCAAATTAAAGAGGACATGTGTTTT
GTGTCACAAAATTTTTAAAAAGATATCAAATTGCGGTAATAATAATTTATTATTAATTCT
TATATGAGATAAATAAATAAATTTAGCAATTAATTAATATCAACACTCTTAGATATTTAT
TCAATTTATAATTTAAAAATAATATCAGAAAAGGCTCTCATACCAAGTATTTTATTTTAC
CTGATTACGAGACAGGTAAAAAAGGTTTTGCTGTAGATTTCTATGATAGATGTAATTAAA
ACATATTTTTAATGATTCTTGCTAACAAATCTTTTCAAATTAAAAGCTTCTTATAGTGAT
AAGCTAACTTTAGACAAAGAGAGATTCACCCTTCCAGAAATATTGTTTAATCCAAGTGAT
ATAGGTATCAAGCACATTATTTTATTTTTTATTCATCATCTTAAATTGAATTAGATAAAA
ATTTGTTAACTATTACCATTTAAAACTCCTTTTCTTAGCAAAAATGATTAGTGATTTTAC
ATTTGAAAATCCCAAAATTAATTGCAAAAATAGAAAGTGTAAATTGTAATTTAAATGGTA
TTCCTTTAAAAAAATAAATCTATCTAAATAAATAAATAATTTAAAAAAATGAAAATAATG
TGAGTAGATATAAATAATTCTCTTAACTGTTTTAAATAGGTTTAGATTAATGTGGTATCT
CATAAGGCGCAAGCAGTGTTATTAAGGAAATACATCCTGATATTAAAGAATACTTCTATG
AGAATATCATTTTATGTGGTGGATCATCAAATTTTGTGGGCTTAAAAGAAAGACTGTAAG
ATATATTAATTAATTAGTTATATTAATTGATTACATTTATTTTACTAAAATTAGATTAAA
TGAAGTCACTTAGAATACTCCTGATTATTTAGATAATAAATTAGTTCATCTCAAAGACAC
TTCATCAGCTTATTAGGGATGTTAAAGGGTAACTTCAGGAGATAATTTTGAAATGCTAGC
TATGAATAGAAATGATTATAAAGAATATGGATTTGAACAACTAAATGCTCTGTATTTTAT
TTGA