Identifiers and Description

Gene Model Identifier

TTHERM_00133470

Standard Name

ARP5 (Actin-related protein 5)

Aliases

PreTt24270 | 10.m00319 | 3698.m00041

Description

Actin family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00133470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05709.19.997093137033517e-262actin family protein (729 aa)
OxytrichaContig19647.0.g162.000043494209831e-96Actin
SGDYNL059C2.998990600740728e-62ARP5 Nuclear actin-related pro
tein involved in chromatin rem
odeling, component of chromati
n-remodeling enzyme complexes
DictyBaseDDB_G02917284.001202823045957e-54arpE on chromosome: 6 position
714429 to 716752
Stentor CoeruleusSteCoe_129031.6889118802245324e-48
WormBaseWBGene000131680.000000000003001226732525078locus:arp-1 status:Confirmed
UniProt:Q9NA98 protein_id
:CAB70110.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00133470(coding)
ATGAAGACATAGAAATATTTAAGAGAGCCTTAAAGATTTTTGATATATGATGTGCGTTAA
TACAATAATCCATTATATGAACCTGCTAGCGATAGAAAACCTACATTGATTTAGAATGAT
TATAATACAGAAATACCAATTTTAATTGACTATGGTAGTGGCATAACAAAAGCTGGTTGG
GGTAATAGTACTAAACCTGATCTCTCAGTGCAATCATTACTTAGCAAGTCTAAAGACTCA
AAAACTAGCATAACTTAGGCATTAACTTCTAGCAAGATAAAAGATGTTGATTTATTCAAG
GGAAATTATAGATCGCCTTATGAAAGAAATATAATATAGCAATTTGGTTTGCTAGAAAAC
CTTAATGATTTTATTTTTAATGAGATTGGTGTAGTTGAATCCAAGGTAGATCATCCTTTG
ATTATAACTGAACCTGTTGCCAACCCAGAATATTGCAGATAAAATTTGCTTGAATAATAT
TTCGAATGTTATGAAATTCCTTCTGTGATGATAGGTGTAGATACATTTTTTGCAACATTT
TATGAATTCGGGTAGGATAGATATCAATCTGAAACATGCTTAATTATAAGTATAGGCCAC
ACCACATGCCACATTATTCCTATGGTAAATGGCTAGATAATTTTTGAAGAAATAAAGAGA
ATAAATGTTGGATATTTTAATAGCTTTGAAGTTCTATATAAGCAGCTTATTTTAAAGAAC
AATCATTAAAAACATCACTTAGATTATTAAACTGTTTAAGCAATACATTTGAATAATTGT
TCTGTTGCTGTTAATTATGATGAATAGCTTAAATATTTAAAATTAGGCACAGATGGTTTC
CAAAATAAATTTTATAGCAATCCTATTGTAAGAGAAAACAACATTCTTACTGATTTAGAG
TGTCTATAAGAACCTATTTACATAGATTTCCCTATACAATAAAAAATTATAGATGAAAGC
GAACTTCTAAGAAAGTAAGAAATTAGATAGAAATAAGCAGAGAGACTTAAAGAAGCAATG
CAAAAAAAAAGGGAAGAGAAAAAAAGAGCTCATGAAAAAGAGTTAGCAGAACTAGAATCA
TTAGAAATTAAATTCAAGGAAGACTAACAATCAGCAAAAATGGTTATAGAGCAGTATTTT
GGTAAAGGTAAGGGAATAGAAGAAGTTCGTAAAAGAATATAAAAAGTCAAAGTAAAACTA
GGCTTTCTCCCAAAAGACACTTTGGAAGAAGATAAATATACCCTAATAAATATTGCAGAT
TCTTAGCTAACAGCTTAGCAACAAAAACAAAAAAAATTACAAATAATACAGAAGCAAGCT
GCAGAAACAAGAGCTGAAAAAAAGGCTCTTGAAAAATAGAAAAAAGAGGAAATAATTAAA
ATGAAAACTTCTAACCCAGAAGTTTATCTGAATATGCTTTATGAAAAAAGATTAAAAATA
ATAAAGAAAGTAGATGAAAAAAAGAAACATCAACAAGAGCTTTCCACTAGAAATTCTAGA
GTTAACTAAAAAAGAATGTAAACTATTGCTTAGTTAGGAGCTTCTGAGAAAATCGGAAAA
GATGATAATTTTGGTATGAACGATGAAGATTGGAATATCTATATTGGCATACAAAAGGAC
TATGAATCAGATGAAGAGAATTAAGAAATGAAGCTAAATGAAATCGAAATAGAATTGAGA
GAAATGGATCCAAATTTTGATGATAAAATCAAAATTGGTGAAGTAAATCCGTACGGTCTT
AGTATGTAAGAACCATTTATAGAACTTTCAGTAGATCGCTTTAGAGGTAACGAAGCTATA
TTCTAGCCAGGAATAGTTGGAGTTGATCAATCAGGTCTTTCAGATGTTATCACATTTGTG
CTTAACAAATTCCCAGCAGAAACATAAGCAAAGCTTCTTTCAAATATAAGAATCACTGGA
GGAGGTAGTGTTATGCAAGGATTAGCTAAAAGAATGGAAAGAGATTTAACTTCTAACTTC
AAGGTAGGAAGTGTTGTTTAAGTTAATCTTATGTCGGAACCTATATTTGGTGCTTGGCTA
GGTATGCAAAAAGTTTATAAATAATATGGAAATAAATTAAATGATTACTTTATTTCTAAG
CAGGAATATTTTGAAAAAGGATCTTCTGAAGGTCTTTTTAAAAGTAATCCTTTTTCAAAT
GTTGTTATTCCTTATTGA


>TTHERM_00133470(protein)
MKTQKYLREPQRFLIYDVRQYNNPLYEPASDRKPTLIQNDYNTEIPILIDYGSGITKAGW
GNSTKPDLSVQSLLSKSKDSKTSITQALTSSKIKDVDLFKGNYRSPYERNIIQQFGLLEN
LNDFIFNEIGVVESKVDHPLIITEPVANPEYCRQNLLEQYFECYEIPSVMIGVDTFFATF
YEFGQDRYQSETCLIISIGHTTCHIIPMVNGQIIFEEIKRINVGYFNSFEVLYKQLILKN
NHQKHHLDYQTVQAIHLNNCSVAVNYDEQLKYLKLGTDGFQNKFYSNPIVRENNILTDLE
CLQEPIYIDFPIQQKIIDESELLRKQEIRQKQAERLKEAMQKKREEKKRAHEKELAELES
LEIKFKEDQQSAKMVIEQYFGKGKGIEEVRKRIQKVKVKLGFLPKDTLEEDKYTLINIAD
SQLTAQQQKQKKLQIIQKQAAETRAEKKALEKQKKEEIIKMKTSNPEVYLNMLYEKRLKI
IKKVDEKKKHQQELSTRNSRVNQKRMQTIAQLGASEKIGKDDNFGMNDEDWNIYIGIQKD
YESDEENQEMKLNEIEIELREMDPNFDDKIKIGEVNPYGLSMQEPFIELSVDRFRGNEAI
FQPGIVGVDQSGLSDVITFVLNKFPAETQAKLLSNIRITGGGSVMQGLAKRMERDLTSNF
KVGSVVQVNLMSEPIFGAWLGMQKVYKQYGNKLNDYFISKQEYFEKGSSEGLFKSNPFSN
VVIPY


>TTHERM_00133470(gene)
ATGAAGACATAGAAATATTTAAGAGAGCCTTAAAGATTTTTGATATATGATGTGCGTTAA
TACAATAATCCATTATATGAACCTGCTAGCGATAGAAAACCTACATTGATTTAGAATGAT
TATAATACAGAAATACCAATTTTAATTGACTATGGTAGTGGCATAACAAAAGCTGTAATT
TACAATTTTAATTGCTTATTTTTTTAATCGCTTAATATAATTATTTTTGTTAAAGGGTTG
GGGTAATAGTACTAAACCTGATCTCTCAGTGCAATCATTACTTAGCAAGTCTAAAGACTC
AAAAACTAGCATAACTTAGGCATTAACTTCTAGCAAGATAAAAGATGTTGATTTATTCAA
GGGAAATTATAGATCGCCTTATGAAAGAAATATAATATAGCAATTTGGTTTGCTAGAAAA
CCTTAATGATTTTATTTTTAATGAGATTGGTGTAGTTGAATCCAAGGTAGATCATCCTTT
GATTATAACTGAACCTGTTGCCAACCCAGAATATTGCAGATAAAATTTGCTTGAATAATA
TTTCGAATGTTATGAAGTAAAAATATTTACAAAATATCTTTATTTTAAAAAAGATGTTAG
TTAGACGCTAAGGGTGATATATTTTTAAAAATTAGATTCCTTCTGTGATGATAGGTGTAG
ATACATTTTTTGCAACATTTTATGAATTCGGGTAGGATAGATATCAATCTGAAACATGCT
TAATTATAAGTATAGGCCACACCACATGCCACATTATTCCTATGGTAAATGGCTAGATAA
TTTTTGAAGAAATAAAGAGAATAAATGTTGGATATTTTAATAGCTTTGAAGTTCTATATA
AGCAGCTTATTTTAAAGAACAATCATTAAAAACATCACTTAGATTATTAAACTGTTTAAG
CAATACATTTGAATAATTGTTCTGTTGCTGTTAATTATGATGAATAGCTTAAATATTTAA
AATTAGGCACAGATGGTTTCCAAAATAAATTTTATAGCAATCCTATTGTAAGAGAAAACA
ACATTCTTACTGATTTAGAGTGTCTATAAGAACCTATTTACATAGATTTCCCTATACAAT
AAAAAATTATAGATGAAAGCGAACTTCTAAGAAAGTAAGAAATTAGATAGAAATAAGCAG
AGAGACTTAAAGAAGCAATGCAAAAAAAAAGGGAAGAGAAAAAAAGAGCTCATGAAAAAG
AGTTAGCAGAACTAGAATCATTAGAAATTAAATTCAAGGAAGACTAACAATCAGCAAAAG
TAAATTAAAAATTTAAATAGGAATATTTTTTAATAGAGTTGTATGGTGCATTATTAATAT
TATTAATGATTCGATAGATAGATTGATACCTGTTCATATTAGTTTTAGAAATAAATTACT
TTCAATTTGCTAATTCAATTAATAAGTTTGAATTTATTTTTATTTTGGCGGAAGTTATCA
ATCACCAATAAAAATTTTATTTTTCATATTTTCAGAAATATTTTAACAAATATTTATTTT
TTAAAAAAGATGGTTATAGAGCAGTATTTTGGTAAAGGTAAGGGAATAGAAGAAGTTCGT
AAAAGAATATAAAAAGTCAAAGTAAAACTAGGCTTTCTCCCAAAAGACACTTTGGAAGAA
GATAAATATACCCTAATAAATATTGCAGATTCTTAGCTAACAGCTTAGCAACAAAAACAA
AAAAAATTACAAATAATACAGAAGCAAGCTGCAGAAACAAGAGCTGAAAAAAAGGCTCTT
GAAAAATAGAAAAAAGAGGAAATAATTAAAATGAAAACTTCTAACCCAGAAGTTTATCTG
AATATGCTTTATGAAAAAAGATTAAAAATAATAAAGAAAGTAGATGAAAAAAAGAAACAT
CAACAAGAGCTTTCCACTAGAAATTCTAGAGTTAACTAAAAAAGAATGTAAACTATTGCT
TAGTTAGGAGCTTCTGAGAAAGTATTTCAATCTATTTATTTTTAAGAATATTACAATCTA
ATTTACTTTTTATTCATTCAAAGATCGGAAAAGATGATAATTTTGGTATGAACGATGAAG
ATTGGAATATCTATATTGGCATACAAAAGGACTATGAATCAGATGAAGAGAATTAAGAAA
TGAAGCTAAATGAAATCGAAATAGAATTGAGAGAAATGGATCCAAGTAATTCAAAAATAC
TTTTTTTATTTAAAAAATTTTTTTTTCTTCTTTTGAAATTTTTTCTTTGAAGTTATTAAA
TAAAGAAGATTAAATTAATAATTTTATAAAGCAATATTTAATTGGTTTTTTTCTAAAAGA
ATTGCTAATAATTATTCAATTATTTTTAAATATATTTGTTTACTAATATTATTTTATTTT
AGATTTTGATGATAAAATCAAAATTGGTGAAGTAAATCCGTACGGTCTTAGTATGTAAGA
ACCATTTATAGAACTTTCAGTAGATCGCTTTAGAGGTAACGAAGCTATATTCTAGCCAGG
AATAGTTGGAGTTGATCAATCAGGTCTTTCAGATGTTATCACATTTGTGCTTAACAAATT
CCCAGCAGAAACATAAGCAAAGCTTCTTTCAAATATAAGAATCACTGTATTTAAATTAAA
GAAAATAATATTTATTTAATTTTTTTATATATTTACAGGGAGGAGGTAGTGTTATGCAAG
GATTAGCTAAAAGAATGGAAAGAGATTTAACTTCTAACTTCAAGGTAGGAAGTGTTGTTT
AAGTTAATCTTATGTCGGAACCTATATTTGGTGCTTGGCTAGGTATGCAAAAAGTTTATA
AATAATATGGAAATAAATTAAATGATTACTTTATTTCTAAGCAGGAATATTTTGAAAAAG
GATCTTCTGAAGGTCTTTTTAAAAGTAATCCTTTTTCAAATGTTGTTATTCCTTATTGA