Identifiers and Description

Gene Model Identifier

TTHERM_00378580

Standard Name

ARP4 (Actin-related protein)

Aliases

PreTt10312 | 40.m00197 | Arp

Description

Actin-related protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.9%

TetraMine Data

TTHERM_00378580

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00115.19.997093137033517e-262actin family protein (399 aa)
OxytrichaContig14403.0.g679.997329401607134e-86Actin
WormBaseWBGene000000674.998071612500574e-77locus:act-5 status:Confirmed
UniProt:O45815 protein_id
:CAB05817.1
SGDYFL039C8.998448382613942e-77ACT1 Actin, structural protein
involved in cell polarization
, endocytosis, and other cytos
keletal functions
DictyBaseDDB_G02894871.0004671766404936e-76act3 on chromosome: 5 position
2884652 to 2885782
Stentor CoeruleusSteCoe_95754.906094730649281e-35

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16732560: Kuribara S, Kato M, Kato-Minoura T, Numata O (2006) Identification of a novel actin-related protein in Tetrahymena cilia. Cell motility and the cytoskeleton 63(7):437-46

Sequences

>TTHERM_00378580(coding)
ATGGATAAACAAAAGGAAAATAAAAGGGCTAAAATGGAAAGTGAGTTTGATGTAAAAGAC
ATCATAGTCATTGATAACGGAGCAGACACAGTAAAAATAGGTATATCTGGAGAAGATAAG
CCAAGAATAATTATTGATTCAATTGGAGGTGAGCCAAAACTAGGAGTTAACGATGAAGCA
ACAAACCAAAAGCCGTAATGTTTGTTTGGACAGTAGTTATAATAAGCTAAAATAGAGAAG
AAGTTTGAGTTAGAAGAGAAATTCCCTATTCAAAATGGAAAAATAGTTGATTTTGATGCT
ATTAGAGATTTGTATACTTATGCCCTAGAAAAGCTGCTCTAAGTAAATGAAATAAGCTCA
TGCAATCTATTAATCATTGATTCTCCACTCAATCCTAAGAATTACAAGCACAAGCTAGCT
GAGATTTTATTCGACGATATGAAAGTTAACTCTGTTCTTTTTTAGAATTCTTCTTCATTA
AGCTTATTCTCTACTGGAGAGACAACTGGGTTAGTAGTTGAATCTGGACATAGTCTAACT
ACATGCATTCCTGTCTTTGAAGGATTTGCTATCCCACATGCTTTTTAGCACTCTTATTTA
GCAGGACAGAAAATGACTGAGATCTTAAAAGAAGAACTTAAAATTCCAGCAGGTCAGCTT
GATGACAATGTGTTTAAGGATATCAAGGAAAGAATGTGCTATGTGGCTAGAGATTACTAC
GTTGATGTAAATGGTCCTACTTTACTCAGCCTTGAAGAAAAATCATATGAACTGCCAGAT
GGAAGCATATTGGAAATAAATAACTCATAAAGATATAAACCAACGGAAATTATATTCAAT
CCTTCAATCATAGGAGACGACAGTATGAGCATACCAGAGATGATGATTGATACTCTTCAT
AGATGTGATGTAGAATTTTAAGAAGAACTGTATAGAAACATAGTATTATGCGGAGGGTCT
TCATTATTTAAGGGTTTTTTACCCCGTATAGAGAAGGAGCTATTAAATGAGGTGACCAAT
ACGATAAATAGAAAAGATATTAATTTTGTTTAAAACACTCATAGAAGGTATTCAGCTTGG
ATTGGAGGATCTATGCTAGGCAGCTTAAGCACTTTCTAGAATTTAGCAATTACTAAAAAT
GAATATGAAGAAAATCCTGAGTCTAAGATGTCAATAATACATAAAAAAACATTTTGA


>TTHERM_00378580(protein)
MDKQKENKRAKMESEFDVKDIIVIDNGADTVKIGISGEDKPRIIIDSIGGEPKLGVNDEA
TNQKPQCLFGQQLQQAKIEKKFELEEKFPIQNGKIVDFDAIRDLYTYALEKLLQVNEISS
CNLLIIDSPLNPKNYKHKLAEILFDDMKVNSVLFQNSSSLSLFSTGETTGLVVESGHSLT
TCIPVFEGFAIPHAFQHSYLAGQKMTEILKEELKIPAGQLDDNVFKDIKERMCYVARDYY
VDVNGPTLLSLEEKSYELPDGSILEINNSQRYKPTEIIFNPSIIGDDSMSIPEMMIDTLH
RCDVEFQEELYRNIVLCGGSSLFKGFLPRIEKELLNEVTNTINRKDINFVQNTHRRYSAW
IGGSMLGSLSTFQNLAITKNEYEENPESKMSIIHKKTF


>TTHERM_00378580(gene)
TTTTCATTATCAAAGTTTGAATTTGCATAAAGATATTTAATTTAATAGTTTTTTTTGTTA
GAACACCTACTCATAAATGGATAAACAAAAGGAAAATAAAAGGGCTAAAATGGAAAGTGA
GTTTGATGTAAAAGACATCATAGTCATTGATAACGGAGCAGACACAGTAAAAATAGGTAT
ATCTGGAGAAGATAAGCCAAGAGTAAACATTTTTAAATATCTAAATGCATTAATTCAAAT
GCATGAATTAGTATAATTTAATGATTAATCTATATAAAAAATGCAGATAATTATTGATTC
AATTGGAGGTGAGCCAAAACTAGGAGTTAACGATGAAGCAACAAACCAAAAGCCGTATTA
AATTTATATAAAATAACGAAAAGCAGCAAAACTTACAATTACTTATGCATTTGGCAAATT
AATCACGTTTTTATTAAACCAAAATAATTTGCGATTAATTTCCAATTACAAGATTTTGAT
TGATTATCTTATCTAATATAATATATTTTATAAAAAAGGTAATGTTTGTTTGGACAGTAG
TTATAATAAGCTAAAATAGAGAAGAAGTTTGAGTTAGAAGAGAAATTCCCTATTCAAAAT
GGAGTAATTAATTAATAAATTGCTTTATTTCGACAAATACGTCTGAAAAAAACAACAATT
TAATTTAAAAATCAAAAAATAAATAAATAGTTACAGATATGTAAAATAGAAAAAAATAAA
CAATAAAACAATAAAACAATAAAGATAAAACAAACACAATTTAAAATTAGTTAAAACAAA
ATTTTAAACATTTAAGATAGAAATATTTTAAATATTTTTCAAATGAATTATTATTTTTTT
AATTTTCAAATGACAGCATAGAAAATCAATTTAAATTATTTAATTGCATTTAATATTTTT
AAAAAATGTTAAAAAATTTATTGTCAAATAAGAATTATTTAGCAACAAGGGTGACTTAAA
ATTGAAATTTAAAAAATATTATTTAATTTAAGAGCCATCTTTATTTAGAGCTTGATATTT
TAATAAGATTTGAAGTATAATTTATTAATTAATTTCAGATTTTAATCTAATAAAAAAGTG
AAAAAAAATTATTCGAGTAACACCCTGATCATTTTTATAAATATAAAACAAAATAATAAT
TAATTTATTAATAAATAATTTAAAAATCAAAATATTAGTTTACACTCAAAACTACTGATT
ATCATCAAGTATTTATTGATTTTTTTAGAAAAAATAAAATAAAATAATCAGAGATCCTTA
AGATTTTTTTTTAATTAATGATTAATTAAATAAGAGATTTTATTAGATTTTTTATCACTC
ATTCATTCATTTATTCATTTATCTATTATTTCATGATGGAGGAATTAATTTATTCATAAA
TATTATGATATAAAATATGAGAATTCATGCATGAAAATTTAAACAAAACAATATTTGTAA
CATGGGAGATCATTAGTTTTTATTTAAATTACAAAGAAAATAGTTGATTTTGATGCTATT
AGAGATTTGTATACTTATGCCCTAGAAAAGCTGCTCTAAGTAAATGAAATAAGCTCATGC
AATCTATTAATCATTGATTCTCCACTCAATCCTAAGAATTACAAGCACAAGCTAGCTGAG
ATTTTATTCGACGATATGAAAGTAAATTAAAAATTTTATAATTTGATACAATTTTCCCTT
TAAAAAGGAATAATAGTACTAAAATTTAAAAAATATAAACAATATTTTAGGTTAACTCTG
TTCTTTTTTAGAATTCTTCTTCATTAAGCTTATTCTCTACTGGAGAGACAACTGGGTTAG
TAGTTGAATCTGGACATAGTCTAACTACATGCATTCCTGTCTTTGAAGGATTTGCTATCC
CACATGCTTTTTAGCACTCTTATTTAGCAGGACAGAAAATGACTGAGATCTTAAAAGAAG
TAAACTAATCTATTTTTAAAACATCCAAAAAATAATTAAAAAAGAGAAATATTTTTATCC
ATCAAAAGGGTTAATTATTTAATTAATTAATTAATTAACACATATTAAAAAATGAAGACT
ATAAAATAAAAGATGCTATCTTTGAATTTAATAAAAACAGAATTTATAAAATTTTGACAC
TTTGTGGAAAATAATTAATTAATTTTTGTTATTCTTTGATAAACCCTTCCTTCCTTCATT
AATAAATAAATAACTAATGGATCATTAAGGAAGAAAAATAACAAATACAATTAAACTAAC
TAATGCTTTCATTTATTTTTTAACAAGGAACTTAAAATTCCAGCAGGTCAGCTTGATGAC
AATGTGTTTAAGGATATCAAGGAAAGAATGTGCTATGTGGCTAGAGATTACTACGTTGAT
GTAAGATAACCTTTTAAATTTATTATATTTAATCATTAAATTTGTACTTTCTTTTATCAG
CAAATTAATTTATTAGAGACTTTATTCAGTTTAAAATTTTTTTTGATTTGTGTTTTTGCT
ATTTTTTGTATTTGTAGACTTTTTAGAATAGCCAGATTAAAACTTTTCCATAAGAGAAAA
AATAAATCAACCTTGTTTGTTCTTTTTGAGTCTATATGTTTTTATGTATGTATGATAATT
AGATAGATATCAGCAAGAGAGAATAAATAATAATTAAATTATATTACTAATTATTGCATT
GATCTGAGACCATATTAATATTTAATTTTAATATTGAAAGGTAAATGGTCCTACTTTACT
CAGCCTTGAAGAAAAATCATATGAACTGCCAGATGGAAGCATATTGGAAATAAATAACTC
ATAAAGATATAAACCAACGGAAATTATATTCAAGTCGGTTAATTTATTAATTAATTAATT
GATTGATTAAATAACTTAAAAATGAATTTTCCTTTATTAGTCCTTCAATCATAGGAGACG
ACAGTATGAGCATACCAGAGATGATGATTGATACTCTTCATAGATGTGATGTAGAATTTT
AAGAAGAACTGTATAGAAACATAGTATTATGCGGAGGGTCTTCATTATTTAAGGGTTTTT
TACCCCGTATAGAGAAGGAGCTATTAAATGAGGTGACCAATACGATAAATAGAAAAGATA
TTAATTTTGTTTAAAACACTCATAGAAGGTATTCAGCTTGGATTGGTAATATTGTCTATA
AAGCATTTATTTAAATGATTAGCATTATCCGGGGCTTTTCTTTCCAACTTAATATTTTCC
TACTTAACTTCTTTTAACTGCATAAAAATGGTTAGTAATGATGATTAATAATTAAATTTT
CAAATAATAGGAGGATCTATGCTAGGCAGCTTAAGCACTTTCTAGAATTTAGCAATTACT
AAAAATGAATATGAAGAAAATCCTGAGTCTAAGATGTCAATAATACATAAAAAAACATTT
TGAACTCTTGAAAATATAAAACATTTAATTAAATTTGTATTTATTTTAAAGCTATTTACA
GAAATCAATGTAAGAAAAATAGAAAGAGAAATATAAGAAAAACCATCAGTAAAAGAAAAA
TAAATAAATAAATAAAAAATTAGATACTTGTTTGTTAATTTATTTTTGTATTTTTTGTTT
ATTTGTTTGTTTGAGAGCTTTATTTATTTTAAGTTGTAAATAAATCATGTAAG