Identifiers and Description

Gene Model Identifier

TTHERM_00442100

Standard Name

ARP3 (Actin-Related Protein )

Aliases

PreTt05610 | 50.m00179 | 3681.m00038

Description

Actin-related protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00442100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12547.19.997093137033517e-262actin family protein (425 aa)
OxytrichaContig14042.0.g941.000274544751666e-156Actin
WormBaseWBGene000001993.99907102031635e-130locus:arx-1 Actin-related pr
otein 3 status:Confirmed U
niProt:Q9N4I0 protein_id:CCD
73510.1
DictyBaseDDB_G02837554.000347951747671e-122arpC on chromosome: 4 position
1135639 to 1137330
SGDYJR065C1.99959632430224e-111ARP3 Essential component of th
e Arp2/3 complex, which is a h
ighly conserved actin nucleati
on center required for the mot
ility and integrity of actin p
atches; involved in endocytosi
s and membrane growth and pola
rity
Stentor CoeruleusSteCoe_308871.733141042341547e-58

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16732560: Kuribara S, Kato M, Kato-Minoura T, Numata O (2006) Identification of a novel actin-related protein in Tetrahymena cilia. Cell motility and the cytoskeleton 63(7):437-46

Sequences

>TTHERM_00442100(coding)
ATGGATAATAAATGCTTCATAGAAAATAAAGTAGCTATTATTGATAATGGTACAGGCTAC
ACAAAAATGGGTTGGGGTGGAAACATTGAACCAACTTATGATATTCCCACAGTCATTTCA
GATAATAGCGATAAAAATTCAGTTTAAGTTAGTAAGAATTACAATGAATAATTAGATTTT
TGCATCGGTAATGATGCCTTGAATTAGTAAGTCAAAACTTATCCTATGAAGTCTGGTATT
GTAACAGACTGGACTTTAATGGAAAAGTTCTGGTAAAAAAGCATATTTGATTATCTTCGT
TGTGATCCCGACGAAACCACATTTGTTCTTACTGAACCTCCTATGAATCCTCCTGAAAAT
AGAGAAAACATAGCAGAAATTTTCTTTGAAACATTTAATGCAAAAAGCATTTATATTGGA
GTTCAAGCCGTGCTCGCTCTCTACTCAAATTAAATGCACGAATAAAATGCCCAAACAGGA
AACAAATTGACTGGTTGCGTCTTAGATTCTGGTGATGGTGTTACTCACATTATTCCAGTC
AGTGATGGATATGTTATCGGTAGTTGTATTAAGCATATTCCTCTTGCTGGTAGAGACATT
ACAAATTTCATAGCTTAAATGATTAGAGATAGAGGTGAAAAAGTTAATAACTAAGACATT
AACAGAATCTCTGCAGAAATTAAAGAAAAGTATGGTTACGTAGCACCTAAAGGTTTATTA
TAAGAATTTGAAAGATATGACAAGCCTGGCAAAGATGGTAAGCCTTCCAATAAATTTAAG
CAATACACTTTCGAAAGTTAAGTTGATAAAAAATAATATACCATGGATGTTGGCTATGAA
CGTTTCTTAGGTCCTGAAATGTTCTTCTACCCTGAATTCTTTGACTCTAAATGGAGAACT
TCTATTGATGAATCTATTGATAATGCAATTTAAGGATCCCCAATTGATACTAGAAGACAT
CTTTATTCAAATATTGTGTTATCTGGTGGTTCTACTATGTTTGAGGGTTTCACTGATAGA
TTATAGTCAGCCATTTAAAAAAGAGTAGATGATAGACTTTTGAGATATTCTACTGCTTTA
AGTAAACCTTAACCAATTGTAGTTTAAGTCGCACAAAATCCTCACTAACGTTTTTCAGTC
TGGTAAGGAGGTAGTTTGCTCTCAATAAAACCCGGCTTTGAAAAAGTATGTAAGAGTAGA
TAAGAATACTTAGAATATGGTCCTTCAATAGTAAGACAAAACGCTGTTTTATCTTCTGGA
ATGTGA


>TTHERM_00442100(protein)
MDNKCFIENKVAIIDNGTGYTKMGWGGNIEPTYDIPTVISDNSDKNSVQVSKNYNEQLDF
CIGNDALNQQVKTYPMKSGIVTDWTLMEKFWQKSIFDYLRCDPDETTFVLTEPPMNPPEN
RENIAEIFFETFNAKSIYIGVQAVLALYSNQMHEQNAQTGNKLTGCVLDSGDGVTHIIPV
SDGYVIGSCIKHIPLAGRDITNFIAQMIRDRGEKVNNQDINRISAEIKEKYGYVAPKGLL
QEFERYDKPGKDGKPSNKFKQYTFESQVDKKQYTMDVGYERFLGPEMFFYPEFFDSKWRT
SIDESIDNAIQGSPIDTRRHLYSNIVLSGGSTMFEGFTDRLQSAIQKRVDDRLLRYSTAL
SKPQPIVVQVAQNPHQRFSVWQGGSLLSIKPGFEKVCKSRQEYLEYGPSIVRQNAVLSSG
M


>TTHERM_00442100(gene)
ATGGATAATAAATGCTTCATAGAAAATAAAGTAGCTATTATTGATAATGGTACAGGGTAA
TGATTATATATTCATTTATTAAGCAAAATAAGCTATCAGAAATTATGCAAGCATACATTT
ATTTTATCTAATATGAATAATCGATTGTCATTAATAATGTATAACATTTTATCAAAAAAG
CTACACAAAAATGGGTTGGGGTGGAAACATTGAACCAACTTATGATATTCCCACAGTCAT
TTCAGATAATAGCGATAAAGTATTTAAGAATTATATGACCTAAAAGATTTACATTTACTT
TAATTTAAAAATAGAATTCAGTTTAAGTTAGTAAGAATTACAATGAATAATTAGATTTTT
GCATCGGTAATGATGCCTTGAATTAGTAAGTCAAAACTTATCCTATGAAGTCTGGTATTG
TAACAGACTGGACTTTAATGGAAAAGTTCTGGTAAAAAAGCATATTTGATTATCTTCGTT
GTGATCCCGACGAAACCACATTTGTTCTTACTGAACCTCCTATGAATCCTCCTGAAAATA
GAGAAAACATAGCAGAAATTTTCTTTGAAACATTTAATGCAAAAAGCATTTATATTGGAG
TTCAAGCCGTGCTCGCTCTCTACTCAAATTAAATGCACGAATAAAATGCCCAAACAGGAA
ACAAATTGACTGGTTGCGTCTTAGATTCTGGTGATGGTGTTACTCACATTATTCCAGTCG
TAAGAATTTTTTTTTTAATACCCAATACATACATAAATATCTTTGATGTGATTTTTTATT
CATTCATTCCAAATAGCTAATAATTAAATTTCTGTCAAACATAAATACAAATCAAATCAA
ATTATTGGTTTCTTTCATTCGCACTTACCTAATAAATTTTTATATTTTAAGGCAAATTAT
ATTAAGATATTTTCAGATTTTTAGAGCTTATATTAAAATCCTATTTATATTTTTAATGAA
TAATTCATTGTATTTTTTTTATATTTAATAAGAGTGATGGATATGTTATCGGTAGTTGTA
TTAAGCATATTCCTCTTGCTGGTAGAGACATTACAAATTTCATAGCTTAAATGATTAGAG
ATAGAGGTGAAAAAGTTAATAACTAAGACATTAACAGAATCTCTGCAGAAATTAAAGAAA
AGTATGGTTACGTAGCACCTAAAGGTTTATTATAAGAATTTGAAAGATATGACAAGCCTG
GCAAAGATGGTAAGCCTTCCAATAAATTTAAGCAATACACTTTCGAAAGTTAAGTTGATA
AAAAAGTAATTAATATTATTTCTAAAGAAAGAATTTAATTTTTATATTGATCTTAATTAA
AGTAATATACCATGGATGTTGGCTATGAACGTTTCTTAGGTCCTGAAATGTTCTTCTACC
CTGTAATTAAATTAATTCTACTCACTAAATATATTAATATTAATGAATTTACTAAAGGAA
TTCTTTGACTCTAAATGGAGAACTTCTATTGATGAATCTATTGATAATGCAATTTAAGGA
TCCCCAATTGATACTAGAAGACATCTTTATTCAGTAAACATTAAAAAATATGATAAATTT
CTTATTCTTTCATAAAAATTATAGAATATTGTGTTATCTGGTGGTTCTACTATGTTTGAG
GGTTTCACTGATAGATTATAGTCAGCCATTTAAGTAATCAGACTTAATTAATTTTTTTAT
GAAATCATACATTTTAATATTAATAATTTAATCTAGAAAAGAGTAGATGATAGACTTTTG
AGATATTCTACTGCTTTAAGTAAACCTTAACCAATTGTAGTTTAAGTCGCACAAAATCCT
CACTAACGTTTTTCAGTCTGGTAAGGAGGTAGTTTGCTCTCAATAAAAGTAAAATCTTAA
TAAAAATCTATAAATCTAATATATTTATCTAAACTTTTAAATGTTAGCCCGGCTTTGAAA
AAGTATGTAAGAGTAGATAAGAATACTTAGAATATGGTCCTTCAATAGTAAGACAAAACG
CTGTTTTATCTTCTGGAATGTGA