Identifiers and Description

Gene Model Identifier

TTHERM_00630470

Standard Name

ARP1 (Acidic Repetitive Protein 1 )

Aliases

PreTt06560 | 89.m00154 | TAP1 | 3831.m01455

Description

Acidic repetitive protein; unknown function; expression of ARP1 not essential for the growth of Tetrahymena.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 90.6%

TetraMine Data

TTHERM_00630470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
WormBaseWBGene000007080.00000000009998509410508463locus:col-135 status:Partial
ly_confirmed UniProt:G3MU58
protein_id:CCD31107.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16732560: Kuribara S, Kato M, Kato-Minoura T, Numata O (2006) Identification of a novel actin-related protein in Tetrahymena cilia. Cell motility and the cytoskeleton 63(7):437-46
  2. Ref:15075259: Fillingham JS, Pearlman RE (2004) Role of micronucleus-limited DNA in programmed deletion of mse2.9 during macronuclear development of Tetrahymena thermophila. Eukaryotic cell 3(2):288-301
  3. Ref:11139619: Fillingham JS, Bruno D, Pearlman RE (2001) Cis-acting requirements in flanking DNA for the programmed elimination of mse2.9: a common mechanism for deletion of internal eliminated sequences from the developing macronucleus of Tetrahymena thermophila. Nucleic acids research 29(2):488-98
  4. Ref:8021245: Heinonen TY, Pearlman RE (1994) A germ line-specific sequence element in an intron in Tetrahymena thermophila. The Journal of biological chemistry 269(26):17428-33

Sequences

>TTHERM_00630470(coding)
ATGAGAAAACAATTTATTGTGCTCCTTCTTATTTCTTTACTTTTAACCGCTGCTTTAGGA
AGAGGTTTAAGAAAGGAAAAACCTATCTAAAAAAGCCATTCTGCTGTTTCAAAAGAAACT
GAAATGACTGAAAACACCCCCAAGCTTATTTAAGATGATGAAGAAAATGCAGATGAAGGT
GATAATGGAGATGATGAAGAATCTGGCGATTCTGATGATGATAGCGGTGATTCAGATGAT
GAAGAATCTGGCGATTCAGATGATGAAGAATCTGGTGATTCTGATGATCAAGAATCTGGT
GATTCTGATGATGAAGAATCTGGTGATTCTGATGATGAAGAGTCTGGTGATTCTGATGAT
GAAGAATCTGGCGATTCTGATGATGATAACGGTGATTCAGATGATGATAATGGTGATTCA
GACGAAGATAACGGTGATGATGATTCAAACGACGACGATAATGGTGATGATGAAAATGGT
GATGATGCCGAAGATGGTGATGATGCCGAAGATGGCGATGATGCTGAAGATGGTGATGAT
GCCGAAGATGGTGATGATGCTGAAGATGGCGATGATGCCGAAGATGGCGATGATGCTGAA
GATGGTGATGATGCTGAAGACGGTGATGCTGCCGAAGATGGTGATGATGCTGAAGACGGT
GATGATGCCGAAGATGGTGATGATAACGAAGATGCCGAAGATGGTGATGATGCTGAAGAT
GGTGATGATGCCGAAGATGGTGATGATAACGAAGATGGCGATGATGCCGAAGATGGTGAT
GATGCTGAAGACGGTGATGATGCCGAAGATGGTGATGATAACGAAGATGCCGAAGATGGT
GATGATGCTGAAGACGGTGATGATGCTGAAGATGGTGATGATGCCGAAGATGGTGATGAT
AACGAAGATGGTGATGATAATGAAGATGGCGATGATGAAGAAGCTTAAGATTAAAGTGAA
CTTATCCAAAAAAATAAGAAATAACAAGTATTAGATAGTAATTGA


>TTHERM_00630470(protein)
MRKQFIVLLLISLLLTAALGRGLRKEKPIQKSHSAVSKETEMTENTPKLIQDDEENADEG
DNGDDEESGDSDDDSGDSDDEESGDSDDEESGDSDDQESGDSDDEESGDSDDEESGDSDD
EESGDSDDDNGDSDDDNGDSDEDNGDDDSNDDDNGDDENGDDAEDGDDAEDGDDAEDGDD
AEDGDDAEDGDDAEDGDDAEDGDDAEDGDAAEDGDDAEDGDDAEDGDDNEDAEDGDDAED
GDDAEDGDDNEDGDDAEDGDDAEDGDDAEDGDDNEDAEDGDDAEDGDDAEDGDDAEDGDD
NEDGDDNEDGDDEEAQDQSELIQKNKKQQVLDSN


>TTHERM_00630470(gene)
ATGAGAAAACAATTTATTGTGCTCCTTCTTATTTCTTTACTTTTAACCGCTGCTTTAGGA
AGAGGTTTAAGAAAGGAAAAACCTATCTAAAAAAGCCATTCTGCTGTTTCAAAAGAAACT
GAAATGACTGAAAACACCCCCAAGCTTATTTAAGATGATGAAGAAAATGCAGATGAAGGT
GATAATGGAGGTAAATTGACAAAAAATTTAAAATAAACAAATATTTACAATTATTTACTT
ATAAATTTAAATTTATTTTCATCAGAAAATATTATGATATTTTTAAATAAATCTATAAAT
CTTTTATTTATTTGAGTTTTACTCATATTTCTCAATGTATTTTCATATTTTTTTAAATTA
TAAAAAGATGATGAAGAATCTGGCGATTCTGATGATGATAGCGGTGATTCAGATGATGAA
GAATCTGGCGATTCAGATGATGAAGAATCTGGTGATTCTGATGATCAAGAATCTGGTGAT
TCTGATGATGAAGAATCTGGTGATTCTGATGATGAAGAGTCTGGTGATTCTGATGATGAA
GAATCTGGCGATTCTGATGATGATAACGGTGATTCAGATGATGATAATGGTGATTCAGAC
GAAGATAACGGTGATGATGATTCAAACGACGACGATAATGGTGATGATGGTAATTTGTTA
TTTTATTATTATAGGTACCATAAACTATTATTAATATCCAACCCGTTGTATTTATTTAAT
ACATACATATTTTCTAGATTTATTATTAAAAAAATATTTTTTTTTTGTTTTATTTTAAAC
GTGTTAATAAAATAAAAATTACAATATATAAACCAATTCAATTAAAATAACAATTTTAAA
TTTACTTTATCATTAAATTAATTTCTTAACTATAAAATTAGAAAATGGTGATGATGCCGA
AGATGGTGATGATGCCGAAGATGGCGATGATGCTGAAGATGGTGATGATGCCGAAGATGG
TGATGATGCTGAAGATGGCGATGATGCCGAAGATGGCGATGATGCTGAAGATGGTGATGA
TGCTGAAGACGGTGATGCTGCCGAAGATGGTGATGATGCTGAAGACGGTGATGATGCCGA
AGATGGTGATGATAACGAAGATGCCGAAGATGGTGATGATGCTGAAGATGGTGATGATGC
CGAAGATGGTGATGATAACGAAGATGGCGATGATGCCGAAGATGGTGATGATGCTGAAGA
CGGTGATGATGCCGAAGATGGTGATGATAACGAAGATGCCGAAGATGGTGATGATGCTGA
AGACGGTGATGATGCTGAAGATGGTGATGATGCCGAAGATGGTGATGATAACGAAGATGG
TGATGATAATGAAGATGGCGATGATGAAGAAGCTTAAGATTAAAGTGAACTTATCCAAAA
AAATAAGAAATAACAAGTATTAGATAGTAATTGA