Identifiers and Description

Gene Model Identifier

TTHERM_00735240

Standard Name

ARF1 (ADP-Ribosylation Factor 1 )

Aliases

PreTt25448 | 120.m00106

Description

ADP-ribosylation factor; regulates vesicle trafficking

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.2%

TetraMine Data

TTHERM_00735240

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10625.16.002263356957296e-125small GTP-binding protein doma
in-containing protein (221 aa)
WormBaseWBGene000001833.9981372112117256e-92locus:arf-3 status:Confirmed
UniProt:G5EFK4 protein_id
:CCD69768.1
OxytrichaContig578.1.g565.999393432078778e-90ADP-ribosylation factor family
DictyBaseDDB_G02891735.0002513615276457e-88arfA on chromosome: 5 position
2516577 to 2517682
SGDYDL192W9.000840820639671e-86ARF1 ADP-ribosylation factor,
GTPase of the Ras superfamily
involved in regulation of coat
ed vesicle formation in intrac
ellular trafficking within the
Golgi; functionally interchan
geable with Arf2p
Stentor CoeruleusSteCoe_354518.194012623990515e-40

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00735240(coding)
ATGGGTATACAACTTTCTAAGCTTTTCGACAAGATTTTCAATAAGGTCGAAATGAGAATT
TTGATGTTAGGTCTCGATGCCGCTGGTAAGACCACCATTCTTTATAGATTGAAGCTCGGT
GAAGTCGTTTAGAGTGTTCCTACCATTGGTTTCAACGTTGAAAGTGTTGAATACAAGAAG
ATTAAATTTACAGTTTGGGACGTCGGCGGTTAAGACAAGATTAGACTCTTATGGAGACAT
TACTTCCAAGGTACCCAAGGTCTCATTTTCGTCGTCGATTCCTCTGATAAGGAACGTATC
GAAATTGCCAAGGAAGAATTACAAAGAATGCTTTCCGAAGATGACCTCAAGGAAGCTGCA
GTCCTTGTCTTCGCCAACAAGCAAGATATGGGTGTCATGAATGTCACTGAAATCACTGAA
AAGTTAGGTCTCGCCAACCTCAGAGGACGTGAATGGTTCATCCAAGGAACCTGCGCTCTC
AGTGGTGAAGGTTTATTCGAAGGTCTTGACTGGCTCTCCAAGGTCGTCAGCAAAAAGAAA
TGA


>TTHERM_00735240(protein)
MGIQLSKLFDKIFNKVEMRILMLGLDAAGKTTILYRLKLGEVVQSVPTIGFNVESVEYKK
IKFTVWDVGGQDKIRLLWRHYFQGTQGLIFVVDSSDKERIEIAKEELQRMLSEDDLKEAA
VLVFANKQDMGVMNVTEITEKLGLANLRGREWFIQGTCALSGEGLFEGLDWLSKVVSKKK


>TTHERM_00735240(gene)
ATGGGTATACAACTTTCTAAGCTTTTCGACAAGATTTTCAATAAGGTCGAAATGAGAATT
TTGATGTTAGGTCTCGATGCCGCTGGTAAGACCACCATTCTTTATAGATTGAAGCTCGGT
GAAGTCGTTTAGAGTGTTCCTACCATTGGTTTCAACGTTGAAAGTGTTGAATACAAGAAG
ATTAAATTTACAGTTTGGGACGTCGGCGGTTAAGACAAGATTAGACTCTTATGGAGACAT
TACTTCCAAGGTACCCAAGGTCTCATTTTCGTCGTCGATTCCTCTGATAAGGAACGTATC
GAAATTGCCAAGGAAGAATTACAAAGAATGCTTTCCGAAGATGACCTCAAGGAAGCTGCA
GTCCTTGTCTTCGCCAACAAGCAAGATATGGGTGTCATGAATGTCACTGAAATCACTGAA
AAGTTAGGTCTCGCCAACCTCAGAGGACGTGAATGGTTCATCCAAGGAACCTGCGCTCTC
AGTGGTGAAGGTTTATTCGAAGGTCTTGACTGGCTCTCCAAGGTCGTCAGCAAAAAGAAA
TGA