Identifiers and Description

Gene Model Identifier

TTHERM_00794600

Standard Name

APN2 (APurinic Nuclease 2)

Aliases

PreTt21459 | 134.m00139 | APE1

Description

Exodeoxyribonuclease III family protein; AP endonuclease; involved in base excision repair pathway

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR00195 ) exodeoxyribonuclease III
  • ( TIGR00633 ) exodeoxyribonuclease III (xth)
  • ( TIGR03395 ) sphingomyelin phosphodiesterase
  • ( PF03372 ) endonuclease/exonuclease/phosphatase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 16%

TetraMine Data

TTHERM_00794600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13338.19.997093137033517e-262exodeoxyribonuclease III famil
y protein (419 aa)
OxytrichaContig20170.0.g421.0004137340105782e-93Endonuclease/Exonuclease/phosp
hatase family
DictyBaseDDB_G02777014.000392704867155e-81apeA on chromosome: 2 position
8367690 to 8368775
WormBaseWBGene000013729.996907204735647e-62locus:exo-3 status:Confirmed
UniProt:G5EBR7 protein_id
:CAB03235.1
Stentor CoeruleusSteCoe_200391.3336148155022614e-34
SGDYBL019W0.000000005997038937208364APN2 Class II abasic (AP) endo
nuclease involved in repair of
DNA damage; homolog of human
HAP1 and E. coli exoIII

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000163

Sequences

>TTHERM_00794600(coding)
ATGATTAAATCTTTTAGATTTTCAGCTTCTAGTCTTTTAAATTTTAGAAACCAATGCTTT
AATACTTAACGTGTAGGTAAGGTATTTTATGCGCCAAAGTTATTAACTTTCCCACTGTTG
AAGTAAAATTTTACTCAGCTCGAAAAAGGCTCAGACTTGCAATAATCAGTAGAAAAATAA
ACTAAAAAGAAAAAAGGTATGAGTAAAATAATTAAAAAATCAAGCTCTATTTCAGAGCCT
GAATAGTCGTAGTCCAGTACTACTACTTAAAAGACTAAAAAGCAGGCTCAATTAGGTGAT
TTCTTTGCTGGAATAAAAAAAAAACCTGAGACCTAAGTTGAAGATAAAGTAGAAATAAAT
ACAGAATTAGGAGATGGAATTTGGAAAGATCGTTAAAATATTAAAATAGCATGTTGGAAT
GTGAATGGATTAAGAGCTGTTTTGAAAAGAGAAGACTTATAAAAGTATATAAAGTAAGAA
AATCCTGATATTCTATGCCTAAATGAAACTAAAATAGATGAATCGAATTTTATAAAAGAA
AAAGTATACAAAGATATTCCTTCAGGCTATTACTAATATTGGAATTTCTGTATACCACCA
ATTAAGGGTTACTCTGGCGTTTCTATTTTCTCTAAAGAAAAAGTCATTAGCATTAAAAAA
GGTATAGATATTGCAGAGCACGAGAACGAAGGAAGGGTTCTTACAGCTGAATTCGATAAA
TTTTATTTAGTTGTAGTTTATGTCCCTAATGCAGGATCGGAATTAGTTAGACTAGATTAT
AGAGTTAATTCGTTTGATAAAGACTTTCAAAATTATTTAAACTAACTAAAATTGAAAAAA
AATGTGATTCTTTGTGGTGATTTAAATGTAGCTCACTAAGAAATAGATATAGCTAATCCC
AAATCTAATAGAAACTCTCCAGGATTTACAATTGAAGAAAGGAATAGCTTTAGTAAATTT
TTAGAAAGTGGATGGATAGATACATTTAGATTTTTATATCCAGAAACTATAAAATATTCT
TGGTGGAGTGTTAGAACTAAAGCTAGAGAATCAAATATAGGATGGAGAATAGATTATTTC
GTTGTAAATAAAGAATTTAAGTCCTCTATTAAAGACTCTATGATAAATAATAATATCTAT
GGAAGTGACCATTGTCCAGTTGAATTTATTTTAAATTTAGATGCTATTTAATAAAATGAA
ACTTCTTCAAACGAAAATACATAAACAAATAAATCTAATTGA


>TTHERM_00794600(protein)
MIKSFRFSASSLLNFRNQCFNTQRVGKVFYAPKLLTFPLLKQNFTQLEKGSDLQQSVEKQ
TKKKKGMSKIIKKSSSISEPEQSQSSTTTQKTKKQAQLGDFFAGIKKKPETQVEDKVEIN
TELGDGIWKDRQNIKIACWNVNGLRAVLKREDLQKYIKQENPDILCLNETKIDESNFIKE
KVYKDIPSGYYQYWNFCIPPIKGYSGVSIFSKEKVISIKKGIDIAEHENEGRVLTAEFDK
FYLVVVYVPNAGSELVRLDYRVNSFDKDFQNYLNQLKLKKNVILCGDLNVAHQEIDIANP
KSNRNSPGFTIEERNSFSKFLESGWIDTFRFLYPETIKYSWWSVRTKARESNIGWRIDYF
VVNKEFKSSIKDSMINNNIYGSDHCPVEFILNLDAIQQNETSSNENTQTNKSN


>TTHERM_00794600(gene)
ATGATTAAATCTTTTAGATTTTCAGCTTCTAGTCTTTTAAATTTTAGAAACCAATGCTTT
AATACTTAACGTGTAGGTAAGGTATTTTATGCGCCAAAGTTATTAACTTTCCCACTGTTG
AAGTAAAGTAATAATAATTATAGTATTACCGCCTAAAGATATTAAATAATATATTGAATT
TTTAAAATTTAGATTTTACTCAGCTCGAAAAAGGCTCAGACTTGCAATAATCAGTAGAAA
AATAAACTAAAAAGAAAAAAGGTATGAGTAAAATAATTAAAAAATCAAGCTCTATTTCAG
AGCCTGAATAGTCGTAGTCCAGTACTACTACTTAAAAGACTAAAAAGCAGGCTCAATTAG
GTGATTTCTTTGCTGGAATAAAAAAAAAACCTGAGACCTAAGTTGAAGATAAAGTAGAAA
TAAATACAGAATTAGGAGATGGAATTTGGAAAGATCGTTAAAATATTAAAATAGCATGTT
GGAATGTGAATGGATTAAGAGCTGTTTTGAAAAGAGAAGACTTATAAAAGTATATAAAGT
AAGAAAATCCTGATATTCTATGCCTAAATGAAACTAAAATAGATGAATCGAATTTTATAA
AAGAAAAAGTATACAAAGATATTCCTTCAGGCTATTACTAATATTGGTAATTTTATCAAA
AAACTATAATTTTTAGTTTTACATTTCTAAAAATATTAAAAAACAAATAAATAATTTTAT
AAATAATTAACATAATAATAGATTAATGAATTAAATTAATTTAGCTTTAATATTGTTATA
AGAATTTATTAAATACATAAATTAATAAACTAAAAAGGAATTTCTGTATACCACCAATTA
AGGGTTACTCTGGCGTTTCTATTTTCTCTAAAGAAAAAGTCATTAGCATTAAAAAAGGTA
TAGATATTGCAGAGCACGAGAACGAAGGAAGGGTTCTTACAGCTGAATTCGATAAATTTT
ATTTAGTTGTAGTTTATGTCCCTAATGCAGGATCGGAATTAGTTAGACTAGATTATAGAG
TTAATTCGTTTGATAAAGACTTTCAAAATTATTTAAACTAACTAAAATTGAAAAAAAATG
TGATTCTTTGTGGTGATTTAAATGTAGCTCACTAAGAAATAGATATAGCTAATCCCAAAT
CTAATAGAAACTCTCCAGGATTTACAATTGAAGAAAGGAATAGCTTTAGTAAATTTTTAG
AAAGTGGATGGATAGATACATTTAGATTTTTATATCCAGAAACTATAAAATATTCTTGGT
GGAGTGTTAGAACTAAAGCTAGAGAATCAAATATAGGATGGAGAATAGATTATTTCGTTG
TAAATAAAGAATTTAAGTCCTCTATTAAAGACTCTATGATAAATAATAATATCTATGGAA
GTGACCATTGTCCAGTTGAATTTATTTTAAATTTAGATGCTATTTAATAAAATGAAACTT
CTTCAAACGAAAATACATAAACAAATAAATCTAATTGA