Identifiers and Description

Gene Model Identifier

TTHERM_01108620

Standard Name

APM2 (Adaptor Protein complex Medium subunit 2 )

Aliases

PreTt20393 | 238.m00043 | 3797.m00202 | APM1A

Description

Homolog of adaptor protein complex (AP-1) medium (mu) subunit; localized to internal structures in cell

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_01108620

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06698.19.997093137033517e-262adaptor complexes medium subun
it protein (444 aa)
OxytrichaContig21523.0.g453.9994088109733696e-178Adaptor complexes medium subun
it family
DictyBaseDDB_G02892479.995404496431436e-166apm1 on chromosome: 5 position
2536641 to 2538194
WormBaseWBGene000068293.0005183738819142e-162locus:unc-101 AP-1 complex s
ubunit mu-1-I status:Confirm
ed UniProt:P35602 protein_
id:CAB05557.3
SGDYPL259C9.999875542736265e-136APM1 Mu1-like medium subunit o
f the clathrin-associated prot
ein complex (AP-1); binds clat
hrin; involved in clathrin-dep
endent Golgi protein sorting
Stentor CoeruleusSteCoe_17914.961148436415422e-78

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16276403: Elde NC, Morgan G, Winey M, Sperling L, Turkewitz AP (2005) Elucidation of clathrin-mediated endocytosis in tetrahymena reveals an evolutionarily convergent recruitment of dynamin. PLoS genetics 1(5):e52

Sequences

>TTHERM_01108620(coding)
ATGCTTTATACATACAATTAACATTTGAAAAATAAAATCTTAGGAAGGAAAACAAACAAC
CAACTATAAAAAATTAAATAAAAATAATAAACAAATTAAGAAGTGAATAGATAAATAGAT
CTTGAATTTATTGTTTATCATTAATAGATTGAAGGTAAAAGCAAATAAATAAATAAGCAA
TTAATTAATAAATTAATAAGTAAATAAATAGTTAATACAAAATACAACTAAAATAGCATA
GAAATCATTTTTTAAAAATATTTTAAGAATTAGAAAGCAATGTCATCCTGTATTAGTACT
GGTATTTCAGCCATCTATATTTTAGATCATAAGGGAAGAGTTCTCATCACAAGATGTTAT
AAAGGTGATTTGCCTATTAACATTCATGATATTTTCAACAAGAAATTGCTTGAATATGAT
GAATTCTCAGTTAAGCCTATTTTGCGTGATAAGTATGGTCACTCTTTCTTCTATTTACAT
CATAATAATTTGATCTTCTTAGCAATTTCTAGAAAGAATACTAACTGCATGATGGTGTTC
AGCTTCTTGTACCAACTTATTTAAGTTTTAGTAGATTATTTTAAGGAATTAGAAGAGGAA
TCTGTACGTGATAATTTTGTTATTATTTATGAACTACTTGATGAAATGATGGATAATGGT
TATCCCCAAACCACTGACAATAAGATTCTTAAAGGATTGATAAAGACTGAATCTCATGAG
TTGAAAAAAGATTAAAAAAAGCCAAGCAAGAATAGTTCTTTGTCAATCGAAAACTAAGTA
GATGCAATTACAGGTGCAGTTACTTGGAGAAACAATGGTATTTCTTACAAAAAGAATGAA
GTCTTTTTGGATGTTATTGAAAAATTAAATATGTTAGTTTCTCATCAAGGTAATGTCATT
AAGTCAGAAATAGCTGGTTAAATTAGAGTTCGTTGTTTCCTTTCCGGTATGCCTGAACTT
AAATTAGGTATCAATGATAAGGCCTTTTATGATGCATAAGGGCGTACTTCTAAGAGTAGA
GCAATAGAATTTGATGATATGAAATTCCATGCCTGCGTGAGATTGTCGAAGTTTGAAAAT
GATAGAGTAATTTCATTCATTCCTCCTGATGGTGAATTTGAATTAGCTTCCTATCGTTTA
GATGTTCGTGTTAAGCCTCTATTTTCAGTTGAAGTTACTCCTGAAAGAAAGCCTAACTCT
AATAAAATTGAATTCACAGTTAAGGTAAAGAGTAATTTCAAGCAAAAATCTACTGCTAAT
AACGTTGAAATCTTTATCCCTGTACCTGATGATGCTGAAACCCCAGTTTTCAAGGCTGCT
TATGGTACTGTCGAATATGTTGCTGAAAAAGAAGCTATGGGATGGAAATTTAAGTAATTC
CCTGGCTAAAGAGAATACATGATGACAGCTACTTTCCACTTGCCTACTGTAGTATCTCCT
AATAGAGAAAAATTCTAAAGAATGCCAATCAGCATCAACTTCGAAATCCCTTACTACACC
GTAAGTGGTTTCTAAGTTAGATATTTAAAAATATAAGAAAAGAGTGGTTATCATGCTCTT
CCTTGGGTTCGTTATATTACATAAAATGGAGATTATCAAATTAGAATGTCTTGA


>TTHERM_01108620(protein)
MLYTYNQHLKNKILGRKTNNQLQKIKQKQQTNQEVNRQIDLEFIVYHQQIEGKSKQINKQ
LINKLISKQIVNTKYNQNSIEIIFQKYFKNQKAMSSCISTGISAIYILDHKGRVLITRCY
KGDLPINIHDIFNKKLLEYDEFSVKPILRDKYGHSFFYLHHNNLIFLAISRKNTNCMMVF
SFLYQLIQVLVDYFKELEEESVRDNFVIIYELLDEMMDNGYPQTTDNKILKGLIKTESHE
LKKDQKKPSKNSSLSIENQVDAITGAVTWRNNGISYKKNEVFLDVIEKLNMLVSHQGNVI
KSEIAGQIRVRCFLSGMPELKLGINDKAFYDAQGRTSKSRAIEFDDMKFHACVRLSKFEN
DRVISFIPPDGEFELASYRLDVRVKPLFSVEVTPERKPNSNKIEFTVKVKSNFKQKSTAN
NVEIFIPVPDDAETPVFKAAYGTVEYVAEKEAMGWKFKQFPGQREYMMTATFHLPTVVSP
NREKFQRMPISINFEIPYYTVSGFQVRYLKIQEKSGYHALPWVRYITQNGDYQIRMS


>TTHERM_01108620(gene)
ATGCTTTATACATACAATTAACATTTGAAAAATAAAATCTTAGGAAGGAAAACAAACAAC
CAACTATAAAAAATTAAATAAAAATAATAAACAAATTAAGAAGTGAATAGATAAATAGAT
CTTGAATTTATTGTTTATCATTAATAGATTGAAGGTAAAAGCAAATAAATAAATAAGCAA
TTAATTAATAAATTAATAAGTAAATAAATAGTTAATACAAAATACAACTAAAATAGCATA
GAAATCATTTTTTAAAAATATTTTAAGAATTAGAAAGCAATGTCATCCTGTATTAGTACT
GGTATTTCAGCCATCTATATTTTAGATCATAAGGGAAGAGTTCTCATCACAAGATGTTAT
AAAGGTGATTTGCCTATTAACATTCATGATATTTTCAACAAGAAATTGCTTGAATATGAT
GAATTCTCAGTTAAGCCTATTTTGCGTGATAAGTATGGTCACTCTTTCTTCTATTTACAT
CATAATAATTTGATCTTCTTAGCAATTTCTAGAAAGAATACTAACTGCATGATGGTGTTC
AGCTTCTTGTACCAACTTATTTAAGTTTTAGTAGATTATTTTAAGGAATTAGAAGAGGAA
TCTGTACGTGATAATTTTGTTATTATTTATGAACTACTTGATGAAATGATGGATAATGGT
TATCCCCAAACCACTGACAATAAGATTCTTAAAGGATTGATAAAGACTGAATCTCATGAG
TTGAAAAAAGATTAAAAAAAGCCAAGCAAGAATAGTTCTTTGTCAATCGAAAACTAAGTA
GATGCAATTACAGGTGCAGTTACTTGGAGAAACAATGGTATTTCTTACAAAAAGAATGAA
GTCTTTTTGGATGTTATTGAAAAATTAAATATGTTAGTTTCTCATCAAGGTAATGTCATT
AAGTCAGAAATAGCTGGTTAAATTAGAGTTCGTTGTTTCCTTTCCGGTATGCCTGAACTT
AAATTAGGTAAAATATTGCATAAAATTTAAAAGTTAGTTTGTTTGCAAGTTAATTTTGAA
AGAAGCAAATATCTTCAAAAAAAAAAAACACGTTTCTTTTTATTTTTGTTGCAGTTTTTA
AAAATAATTTTAGTGTTTTTAACTTTCGCATTCTGCAAAATCATTCTTCTGAATTGAAAA
TTTAGAAAGGCATTCTCCTCTAACATTTCAAATGCTTAAATTTTCGAGAATAAAATAGAT
TTAGGAATTGTCTTAGTTTTGAAAGTTAAAAAAATCAGCAATCATTAGGTTTAATTATTT
ATGACTTATAAAATTTATTTAGAGATCAATTAAAATTCAAAATTTTATTTAAAAATCGTC
TCTTCAGAAATCAATATAAAGCAGATATGAATTAATTAATACAAGAAACAAAAAAAATTA
TCTCACTCACAGATTAATGTTTTTCAATGAGGTGAGATAGTTGTTTCTGATATCTTTGAA
AAGCTCTCATTTTTAAGAGCAAGATTGAAAAATAAAATTCATTACACTTATATTTATTTA
TATTTTAAATCAGGTATCAATGATAAGGCCTTTTATGATGCATAAGGGCGTACTTCTAAG
AGTAGAGCAATAGAATTTGATGATATGAAATTCCATGCCTGCGTGAGATTGTCGAAGTTT
GAAAATGATAGAGTAATTTCATTCATTCCTCCTGATGGTGAATTTGAATTAGCTTCCTAT
CGTTTAGATGTTCGTGTTAAGCCTCTATTTTCAGTTGAAGTTACTCCTGAAAGAAAGCCT
AACTCTAATAAAATTGAATTCACAGTTAAGGTAAAGAGTAATTTCAAGCAAAAATCTACT
GCTAATAACGTTGAAATCTTTATCCCTGTACCTGATGATGCTGAAACCCCAGTTTTCAAG
GCTGCTTATGGTACTGTCGAATATGTTGCTGAAAAAGAAGCTATGGGATGGAAATTTAAG
TAATTCCCTGGCTAAAGAGAATACATGATGACAGCTACTTTCCACTTGCCTACTGTAGTA
TCTCCTAATAGAGAAAAATTCTAAAGAATGCCAATCAGCATCAACTTCGAAATCCCTTAC
TACACCGTAAGTGGTTTCTAAGTTAGATATTTAAAAATATAAGAAAAGAGTGGTTATCAT
GCTCTTCCTTGGGTTCGTTATATTACATAAAATGGAGATTATCAAATTAGAATGTCTTGA