Identifiers and Description

Gene Model Identifier

TTHERM_00577030

Standard Name

APM2 (Adaptor Protein complex Medium (Mu) subunit )

Aliases

PreTt28990 | 77.m00202 | 3812.m02678

Description

homolog of adaptor protein complex (AP-2) medium (mu) subunit; localized near coated pits and the contractile vacuole pores

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00577030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_96260
Tetrahymena borealisEI9_04058.19.997093137033517e-262adaptor complexes medium subun
it protein (433 aa)
OxytrichaContig21325.0.g909.997316819378982e-180Adaptor complexes medium subun
it family
DictyBaseDDB_G02771398.001983224960958e-155apm2 on chromosome: 2 position
7788092 to 7789756
WormBaseWBGene000010828.00283818813536e-121locus:dpy-23 AP-2 complex su
bunit mu status:Confirmed
UniProt:P35603 protein_id:CC
D68419.1
SGDYPL259C8.002331242114626e-85APM1 Mu1-like medium subunit o
f the clathrin-associated prot
ein complex (AP-1); binds clat
hrin; involved in clathrin-dep
endent Golgi protein sorting

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16276403: Elde NC, Morgan G, Winey M, Sperling L, Turkewitz AP (2005) Elucidation of clathrin-mediated endocytosis in tetrahymena reveals an evolutionarily convergent recruitment of dynamin. PLoS genetics 1(5):e52

Sequences

>TTHERM_00577030(coding)
ATGATTAGCTCTATTGTTTTTATTAACTCTAAAGGTGAAATCTTAATTTATAGAATTTAT
AAGGATGATATTAGCAGAGCAGAGACTATGTAATTCTGCACAAATGTAGTAGCTCGTAAG
GAAAGCAAAGAATCCCCTATTGTAAACATAGATGGTACTTCATTTATCCACGTCAGCTAC
AAAGATATAATATTATTAGCCACAACTAAATGTAATATAAATGCTGCTATGACAATTTAG
TTTCTTTATTAGTTGATAAATGTTTGCAAGTCCTATTTTGGTGATTTCGATGAAAACAAT
ATTCGTAAATAGTTTGTTCTCATCTATGAATTGCTCGATGAAATTATGGATTATGGTCTT
CCTTAAATTCTAGACCCCGATCTTTTAAAGTAATCAATTCAAGAAGGAGGCAAGCAAGAT
GGCATGACTGATATAGAAAAATTAAAATAATTTACTTAATAAGCTACTAATGCTTAATCG
TGGAGAGCACCAAACATTTTCTACAAAAAGAATGAAGTCTACATTGATATTATAGAAAGC
GTAAATGTAAGTATGTCAGTTAAGGGATCTATCCTTAAAGCTGATGTCTCAGGAAAAGTT
ATGGTAAAAGCTCTACTCAGTGGTGTCCCTGATTGTAAATTTGGTATGAATGACAAGGTC
TTAATGGAAAAAGAACCTCCTAAACCAGGTTCAAATCCTTAATAAGGTGGCTAAAACAAT
AAGGGTATTACAATCGATGACTTAAAGTTCCATCCTTGTGTAGTCCTTCCCAAGTTTGAC
AAAGAAAGAGCTATCACATTCACTCCTCCTGATGGTGAGTTCTAGCTAATGAGCTACAGA
ATTACTGAGAATGTCAATTTACCTTTCAAAATAATGCCCGTAATTAACGAAGATGGAAAT
AATATTGAAGTAAGAGTAAAGCTAAAATCTATTTTTGATAAAACTCAATATGCAACTAAT
GTTGCTTTAAAGGTTCCTTGCCCTAAAAATACTGCAAACACATCAAACACTGCTAGTATA
GGAAGAGCTAAATATGAACCAGAATAAGGAGGTATCGTTTGGAGAATAAAGAAGTTCTAG
GGAGAAACTGAAGCTCTTCTTAGATGTGAAATCGTGTTGAGTAATACTGCTCTTGATAAA
AATTGGGTAAAACCTCCTATATCTCTTGAATTCTAAGTTCCATCATTTACAGCAAGTGGC
TTGAGAGTAAGATTCTTGCGTATTCATGAAAAAAGTGGTTATCACCCTACAAAATGGATT
CGTTATATAACTAAGGGTGGTGAATATCTTCATCGTATATGA


>TTHERM_00577030(protein)
MISSIVFINSKGEILIYRIYKDDISRAETMQFCTNVVARKESKESPIVNIDGTSFIHVSY
KDIILLATTKCNINAAMTIQFLYQLINVCKSYFGDFDENNIRKQFVLIYELLDEIMDYGL
PQILDPDLLKQSIQEGGKQDGMTDIEKLKQFTQQATNAQSWRAPNIFYKKNEVYIDIIES
VNVSMSVKGSILKADVSGKVMVKALLSGVPDCKFGMNDKVLMEKEPPKPGSNPQQGGQNN
KGITIDDLKFHPCVVLPKFDKERAITFTPPDGEFQLMSYRITENVNLPFKIMPVINEDGN
NIEVRVKLKSIFDKTQYATNVALKVPCPKNTANTSNTASIGRAKYEPEQGGIVWRIKKFQ
GETEALLRCEIVLSNTALDKNWVKPPISLEFQVPSFTASGLRVRFLRIHEKSGYHPTKWI
RYITKGGEYLHRI


>TTHERM_00577030(gene)
ATGATTAGCTCTATTGTTTTTATTAACTCTAAAGGTGAAATCTTAATTTATAGAATTTAT
AAGGATGATATTAGCAGAGCAGAGACTATGTAATTCTGCACAAATGTAGTAGCTCGTAAG
GAAAGCAAAGAATCCCCTATTGTAAACATAGATGGTACTTCATTTATCCACGTCAGCTAC
AAAGATATAATATTATTAGCCACAACTAAATGTAATATAAATGCTGCTATGACAATTTAG
TTTCTTTATTAGTTGATAAATGTTTGCAAGTCCTATTTTGGTGATTTCGATGAAAACAAT
ATTCGTAAATAGTTTGTTCTCATCTATGAATTGCTCGATGAAGTAAATATTTAAAATTTA
ACATTTAGAAATAGATTAATATGATAAACCAATCTTTATTAGTTCCCAAAAATCTAAAAA
AAAACGAAAAATAAAGTTAGTTATGTTATTTAAATAACATTTATAATCAAAGTGTAATTG
ACTATTGAAAAGGTTAATAAAATATCCTTTTAATACAATCGAATAATGGATTTATGAAGA
TATTTCTTTCTAAATAAAAATGAAATATTTGAAATCTTTAATTTATCAAAAAAAAAAATT
TTTTTTTCTTTCTATAAAAAAAGATTATGGATTATGGTCTTCCTTAAATTCTAGACCCCG
ATCTTTTAAAGTAATCAATTCAAGAAGGAGGCAAGCAAGATGGCATGACTGATATAGAAA
AATTAAAATAATTTACTTAATAAGCTACTAATGCTTAATCGTGGAGAGCACCAAACATTT
TCTACAAAAAGAATGAAGTCTACATTGATATTATAGAAAGCGTAAATGTAAGTATGTCAG
TTAAGGGATCTATCCTTAAAGCTGATGTCTCAGGAAAAGTTATGGTAAAAGCTCTACTCA
GTGGTGTCCCTGATTGTAAATTTGGTATGAATGACAAGGTCTTAATGGAAAAAGAACCTC
CTAAACCAGGTTCAAATCCTTAATAAGGTGGCTAAAACAATAAGGGTATTACAATCGATG
ACTTAAAGTTCCATCCTTGTGTAGTCCTTCCCAAGTTTGACAAAGGTAATTATTTATTTA
TTTAGTTTTTTAAATGAAAAAGGTTTGATCTCCTTTATGAAATTTCATTATTAAGTTAAA
AAAATATAGTAAAATTAAGAAATAGATAGATATGTTTGATTTCTGTCAAAAATTTGAATT
ATTTAAAAAAATAATATAAAACAGAAAGAAGGATTAAAAAAAACATAAATGTTGCAAAAT
AAAATTTCAAATAATTCAATTTTATTATAGGATTTTCACTTTAGTGCAAATTTAAATCCT
TTCAAAATAATTTTTATTTCTATTTATATATAGAAAGAGCTATCACATTCACTCCTCCTG
ATGGTGAGTTCTAGCTAATGAGCTACAGAATTACTGAGAATGTCAATTTACCTTTCAAAA
TAATGCCCGTAATTAACGAAGATGGAAATAATATTGAAGTAAGAGTAAAGCTAAAATCTA
TTTTTGATAAAACTCAATATGCAACTAATGTTGCTTTAAAGGTTCCTTGCCCTAAAAATA
CTGCAAACACATCAAACACTGCTAGTATAGGAAGAGCTAAATATGAACCAGAATAAGGAG
GTATCGTTTGGAGAATAAAGAAGTTCTAGGGAGAAACTGAAGCTCTTCTTAGATGTGAAA
TCGTGTTGAGTAATACTGCTCTTGATAAAAATTGGGTAAAACCTCCTATATCTCTTGAAT
TCTAAGTTCCATCATTTACAGCAAGTGGCTTGAGAGTAAGATTCTTGCGTATTCATGAAA
AAAGTGGTTATCACCCTACAAAATGGATTCGTTATATAACTAAGGGTGGTGAATATCTTC
ATCGTATATGA