Identifiers and Description

Gene Model Identifier

TTHERM_00455300

Standard Name

APM1B (Adaptor Protein complex Medium (Mu) subunit )

Aliases

PreTt20259 | 53.m00161 | 3712.m00022

Description

Adaptor complexes medium subunit family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01217 ) Clathrin adaptor complex small chain
  • ( PF00928 ) Adaptor complexes medium subunit family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00455300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13727.19.997093137033517e-262adaptor complexes medium subun
it protein (440 aa)
OxytrichaContig21523.0.g453.999622461503957e-161Adaptor complexes medium subun
it family
DictyBaseDDB_G02892472.0000633521090825e-149apm1 on chromosome: 5 position
2536641 to 2538194
WormBaseWBGene000001502.000893364583308e-148locus:apm-1 status:Confirmed
UniProt:O01755 protein_id
:CCD65442.1
SGDYPL259C2.000808864924972e-124APM1 Mu1-like medium subunit o
f the clathrin-associated prot
ein complex (AP-1); binds clat
hrin; involved in clathrin-dep
endent Golgi protein sorting
Stentor CoeruleusSteCoe_316204.408531331463226e-71

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16276403: Elde NC, Morgan G, Winey M, Sperling L, Turkewitz AP (2005) Elucidation of clathrin-mediated endocytosis in tetrahymena reveals an evolutionarily convergent recruitment of dynamin. PLoS genetics 1(5):e52

Sequences

>TTHERM_00455300(coding)
ATGTCTGGAATTTCAGGAATATTTATCCTTAATAATAAAGGAAGAGTTATTATTCAAAGA
GTTTATCGTGCTGATTTACAAGTGCATGTAATTGAAACATTTAATAAAAAATTAGTTGAA
TTTGATGAATTCAATCAAAAGCCTATTGTCTAAGATGAGTTTGGAAATACTTACATTTAT
AGAAATCACAACAATTTAACTTTTTTGATCATTACAAGAAGAAATACTAATGTTATGATG
GTTTTTGCCTTCTTGTATTAGTTTATCGAAGTTTTAGTTCATTATTTTAAAGAGCTGGAA
GAAGAATCTGTCAGAGATAATTTTGTAGTAATTTATGAATTATTAGATGAAGTTTTAGAT
AATGGATATCCTCAAATTACTGACTGCAAAAACTTATCTGAATTTATTAAAACAGAAAGT
CATGAGCTAGTTAAAGATTCTTTCTTTGGAGGAAAAGAAAAAAAAGAAGAAAATTTATCA
AAGTATGCAACTATGTCAACAGCAGCTATTTCATGGAGACCTGAAGGAATTAAATATAAA
AAGAATGAAATCTTCTTAGATGTTTATGAAAAGCTAAATATGCTAATTGGTAAAACTGGT
AACGTTATTGAAGCTGAAATCATAGGTAATGTAGTTGCAAATTCTATGCTTTCAGGTATG
CCTGACTGTAAGCTCGGCTTAAATGATAAAGCATATTTTGAAGCTATAGGTAGATCCACA
AATGCAAGAACAATTAACTTTGAAGATATGAAATTCCATTAATGTGTTCGTTTATCTAAA
TTTGAAAATGAAAGGCTCATTACTTTTATTCCTCCTGATGGTGAATTCGAACTGATTTCA
TATAGAATTCCTGTTCAAATTAAGCCTCTCTTCTAAGTGGATGTAATTATTACCCAACCT
AAACCAACTAAAATTGAAATAATGGTAAAAGCCAAGTCTAATTTTAAAGAGAAATCAACA
GCAAATGATGTCGACATATATATACCTGTTCCTGAAGATGTATAGAAACCAGAATTTAAG
TGTGCTTTTGGTAAATCAATCTGGGATTAAGGACGCGAAGCTATCAAATGGAGCTTCAAG
TAATTTGTTGGTCAAAAAGAATATATCATGTAATGCACTTTCAATTTACCCACAGTTGCT
TCTCCTGGTAGAGAAAAATATAAATAAGTACCTATTTCTATTAATTTCGAAATTCCATAT
TACACTGTTAGCGGCTTCTAAGTTAGATATCTTAAAGTTGAAGAGAGAAGTGGCTATAAT
GCACTTCCATGGGTTCGTTATGTAACTAAAAATGGCGATTACTAAATAAGAATGTTTTGA


>TTHERM_00455300(protein)
MSGISGIFILNNKGRVIIQRVYRADLQVHVIETFNKKLVEFDEFNQKPIVQDEFGNTYIY
RNHNNLTFLIITRRNTNVMMVFAFLYQFIEVLVHYFKELEEESVRDNFVVIYELLDEVLD
NGYPQITDCKNLSEFIKTESHELVKDSFFGGKEKKEENLSKYATMSTAAISWRPEGIKYK
KNEIFLDVYEKLNMLIGKTGNVIEAEIIGNVVANSMLSGMPDCKLGLNDKAYFEAIGRST
NARTINFEDMKFHQCVRLSKFENERLITFIPPDGEFELISYRIPVQIKPLFQVDVIITQP
KPTKIEIMVKAKSNFKEKSTANDVDIYIPVPEDVQKPEFKCAFGKSIWDQGREAIKWSFK
QFVGQKEYIMQCTFNLPTVASPGREKYKQVPISINFEIPYYTVSGFQVRYLKVEERSGYN
ALPWVRYVTKNGDYQIRMF


>TTHERM_00455300(gene)
ATGTCTGGAATTTCAGGAATATTTATCCTTAATAATAAAGGAAGAGTTATTATTCAAAGA
GTTTATCGTGCTGATTTACAAGTGCATGTAATTGAAACATTTAATAAAAAATTAGTTGAA
TTTGATGAATTCAATCAAAAGCCTATTGTCTAAGATGAGTTTGGAAATACTTACATTTAT
AGAAATCACAACAATTTAACTTTTTTGATCATTACAAGAAGAAATACTAATGTTATGATG
GTTTTTGCCTTCTTGTATTAGTTTATCGAAGTTTTAGTTCATTATTTTAAAGAGCTGGAA
GAAGAATCTGTCAGAGATAATTTTGTAGTAATTTATGAATTATTAGATGAAGTTTTAGAT
AATGGATATCCTCAAATTACTGACTGCAAAAACTTATCTGAATTTATTAAAACAGAAAGT
CATGAGCTAGTTAAAGGTAATTAATTTATCTCAAATAGCCTCAAGCTTATTTTACAGAAA
TATTAAAATCAATATTTCAAAAATAGAATTTAATTTGAAAATCATGATTGTGCAAATTTT
GATTTATTGTCACTCATAAAATGGCTTAAATCTTCTAAGCTAATTATTTATTTATATGAG
ATATTATTAATGATGTAAACTAATTAAATCATTTTTCATTTACAAAAATAGATTCTTTCT
TTGGAGGAAAAGAAAAAAAAGAAGAAAATTTATCAAAGTATGCAACTATGTCAACAGCAG
CTATTTCATGGAGACCTGAAGGAATTAAATATAAAAAGAATGAAATCTTCTTAGATGTTT
ATGAAAAGCTAAATATGCTAATTGGTAAAACTGGTAACGTTATTGAAGCTGAAATCATAG
GTAATGTAGTTGCAAATTCTATGCTTTCAGGTATGCCTGACTGTAAGCTCGGCTTAAATG
ATAAAGCATATTTTGAAGCTATAGGTAGATCCACAAATGCAAGAACAATTAACTTTGAAG
ATATGAAATTCCATTAATGTGTTCGTTTATCTAAATTTGAAAATGAAAGGCTCATTACTT
TTATTCCTCCTGATGGTGAATTCGAACTGATTTCATATAGGTAAAATCATTAAATGTCAT
TTAAATTATCTTATTTTAAAAATATAAAGAATTCCTGTTCAAATTAAGCCTCTCTTCTAA
GTGGATGTAATTATTACCCAACCTAAACCAACTAAAATTGAAATAATGGTAAAAGCCAAG
TCTAATTTTAAAGAGAAATCAACAGCAAATGATGTCGACATATATATACCTGTTCCTGAA
GATGTATAGAAACCAGAATTTAAGTGTGCTTTTGGTAAATCAATCTGGGATTAAGGACGC
GAAGCTATCAAATGGAGCTTCAAGTAATTTGTTGGTCAAAAAGAATATATCATGTAATGC
ACTTTCAATTTACCCACAGTTGCTTCTCCTGGTAGAGAAAAATATAAATAAGTACCTATT
TCTATTAATTTCGAAATTCCATATTACACTGTTAGCGGCTTCTAAGTTAGATATCTTAAA
GTTGAAGAGAGAAGTGGCTATAATGCACTTCCATGGGTTCGTTATGTAACTAAAAATGGC
GATTACTAAATAAGAATGTTTTGA