Identifiers and Description

Gene Model Identifier

TTHERM_00444320

Standard Name

APG2 (The gamma subunit of the AP-2 adaptin complex)

Aliases

PreTt03800 | 51.m00166 | 3704.m00021

Description

Adaptin AP-2 gamma subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF02985 ) HEAT repeat
  • ( PF04899 ) MbeD/MobD like
  • ( PF01602 ) Adaptin N terminal region
  • ( PF03130 ) PBS lyase HEAT-like repeat
  • ( PF00514 ) Armadillo/beta-catenin-like repeat
  • ( PF08752 ) Coatomer gamma subunit appendage domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00444320

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10925.19.997093137033517e-262adaptin N-terminal region fami
ly protein (925 aa)
OxytrichaContig3797.0.g327.001585505934824e-125Adaptin N terminal region
DictyBaseDDB_G02893712.000277046697593e-115copG on chromosome: 5 position
2724036 to 2727148
WormBaseWBGene000117753.9998808708412595e-103Probable coatomer subunit gamm
a status:Confirmed UniProt
:Q22498 protein_id:CAA93095.
1
SGDYNL287W3.999329394025902e-72SEC21 Gamma subunit of coatome
r, a heptameric protein comple
x that together with Arf1p for
ms the COPI coat; involved in
ER to Golgi transport of selec
tive cargo
Stentor CoeruleusSteCoe_4865.5210822770285325e-42

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00444320(coding)
ATGGCTCACCTCATTAAATAAGTGTCAGAAAAATTCTAAAAGCTTCAAAATGATTTTAGG
AGAAATACCATAGAAGTAGATGCTTTTAGTAAGATTAGCAAATCATAGGTCCTTTAAGAT
TGTAAGTAATTTACTAGCGTATAGTTAAACGATCGTTAATGCAGATAATTATTATCTCAA
TTAATCTATCTTATCAACTAAGGAAATAAGTTCAGTGATTAAGAGTAGTCAACTTTATTT
TTCTAAGTTACAAGATTGTTTTAATCAAACAACAAAGAATTACGTAGAATGGTCTACCTC
ATGATCAAAGAATTCAAAGATGAAAAAATGGTCTATGTTGTCACATAATCTTTGATGAAA
GATATTACTTCTACTGTTGACTTATATAAGATGAATGCTTTGAGAATTATTCCAGTTGTT
TTAGATCCTTCTAATCTTATTTAAGTTGAACGCTACATCAAAAACGCTATTCTTGATAAA
AATACTGCTGTAGCCAGTGCAGCTATATTGGCAGCCATATAATTATTCCCTTAACATAGT
GAATCTATGAAAAAATTAAGCTCTGATGTAACTGCTGCACTTCAAAACAATAAAACTTAA
TCCACAATCCATTTCCACGCCTAAATTCTACTTCATGAAATAAAAAAATAAGATAGAAAC
TCATACATTAAGATTTTGCTTGAATAGACAAAGGATGCCATTGGCAACTCTGGCCACTTC
TCTACTATTTAACTTATCAGATTTATCAAAGAAGTTCTCTTAACATCTGAGTTGGATTAG
ACAACAGAAAGAACATTTATTGATTACTTAACAAGACAAACAAGTAAAACTAATGAAATG
GTGACTATTGAAAGTTGCAAGGCTATTTGTGAACTTAAAAATATCTCAAATAAAGATTTA
ACTCAACCAATAACAGTTTTGGGTATTTTCTTGGTTGGAAGTAGCACAGTTAACAAATAT
GCTGCCTTGAAGATTATGAATAAGCTTGTATCTAATCCTGCTAGAAAAGCTATCATCAAC
AATAAAACTGAAATACAATACCTTCTAACTGATAATAACAAGAGTATTTCTTCTTTAGCT
GTTTCCATCTTGCTTAAATTGTGTAATGAAGATGACATAGAGAGTTTGCTTAATTAAATT
TATGATAATCTTTAAGACATGTCTGATGAATTTAAAGTTGACATACTTAATTCTGTTAAA
GGGCTTGTCAAATAACTTCCCAAAAAATATAGAATTATTTTAGTTTTCTTATTCAATTGT
ATGAAAAACGAAGGAAATGCTGATTTCAAAGCATAATGCATTGATGTTGTAGAAGATATT
ATTAGACAATTCCCTGCTGAAGAAGTTAGAGAATCTAGTTTATAGGTCTTATCTGAGTAT
ATTGAAGATTGTTTAGTAAAAAGTTTATAATTAAAATGCTTGAGCATTATCAACAAAGAG
TCGTCCAAGAATACTGCTTCTCTTAAAATGATTAGACTTATTAACAACAGAATTCACTTA
GAAGATTCTGAAGTAAGAGCTGCTGCTGTAGGTACTATTTCTAAATTTGCATCAAAGCAA
TAATCTGTTAGAGAATAAGTTATCTAACTCTTGAAACATGCTTTGAGTGATCCTGATGAA
GAAGTCAGAGAAAGAGCATTCTAAAGTATTAATATTTTTAGTGAGCAAGTTAGTTCTTTC
TTAGAAGATAAAGCTAGAGAAGCTTCAACAATTGATTTCTAAGAAATTACATATATAGAA
AAATATATTGAAATGAACAAGCAAAATATTGAAGAATCAGAAGATATTGAAGCACTTTCC
AAGGATAAAATATATGAATTTGCATAAGCATAAAATATTCAAGCAACATAAACTTCTGAA
AATTAAGCATCAACAAATTATGATGATTTTTCATCTGATCCTTCTTAAGACAAGGAAGAA
TCTTAAGCTTCTGCTAGTTTACCAGTTATTAAAAAGGATAATGAATAATTCTAAAAATTA
GCACAATAATTTGCTTCCAGCGCTATTTTCTAAGGTTATGGACCTCTCAGACATATTTCT
AATGGAGGAGATCTTACTGACAAAAATGCTAGTTATTTAGTAAGCTATGTCAAATACTTC
TTTGATGATTATGTTGTCTTAGAATTTTTAGTAAAAAACAAAGCTCAAGACCAAATTCTT
AAAGATGTGAAGGTTAAGTTAGATTTAAATAATGAAAACATTCAAGTAGAAAAGATTGTT
GCAGCCACTGAAATTAAAGAAGAAGAAGCAAGCAATATTTTTGTTGCTTTGGCAAGAAAC
CCTGAATTTAAAGTTATTGCTTTCTCTAGCCAATGCTTCTTAACTTTCTAAGTTTAAGAT
ATAGGAGCTAATGGTAAAGTTATTTCTGAATATGCAGATGAATACTAACTAGATGATGTC
TAAGTAACTATTTCCGATCATTTAACTAATTGGGAAATTGGTAAAGGAAAATACGAAACA
GAATTAAATTATTTAGAAGGAGAAGTTGCTACATAAAAGTTTAAATTATCATACAAGAGT
ATTGATTTTGCTATCTAAGAAATTATTAAGCACTTCAGTGTAAGCGTATGTGATGGAACA
AATCACATTCCTCAAGTTCAAACAGAAAAATTCCATACTCTTAAACTAGCTGGTAAATAC
TTAGATAAAGAAAAGTTCTTATTAAGCTGCATGATAGCTATGGATGCTAAATAAGGTTGC
TTCTTACAAATGAATGTTAAGAGCGCAGACGAAGAATTAAACTAAGATCTTATAAATACT
TTCAATAACTGA


>TTHERM_00444320(protein)
MAHLIKQVSEKFQKLQNDFRRNTIEVDAFSKISKSQVLQDCKQFTSVQLNDRQCRQLLSQ
LIYLINQGNKFSDQEQSTLFFQVTRLFQSNNKELRRMVYLMIKEFKDEKMVYVVTQSLMK
DITSTVDLYKMNALRIIPVVLDPSNLIQVERYIKNAILDKNTAVASAAILAAIQLFPQHS
ESMKKLSSDVTAALQNNKTQSTIHFHAQILLHEIKKQDRNSYIKILLEQTKDAIGNSGHF
STIQLIRFIKEVLLTSELDQTTERTFIDYLTRQTSKTNEMVTIESCKAICELKNISNKDL
TQPITVLGIFLVGSSTVNKYAALKIMNKLVSNPARKAIINNKTEIQYLLTDNNKSISSLA
VSILLKLCNEDDIESLLNQIYDNLQDMSDEFKVDILNSVKGLVKQLPKKYRIILVFLFNC
MKNEGNADFKAQCIDVVEDIIRQFPAEEVRESSLQVLSEYIEDCLVKSLQLKCLSIINKE
SSKNTASLKMIRLINNRIHLEDSEVRAAAVGTISKFASKQQSVREQVIQLLKHALSDPDE
EVRERAFQSINIFSEQVSSFLEDKAREASTIDFQEITYIEKYIEMNKQNIEESEDIEALS
KDKIYEFAQAQNIQATQTSENQASTNYDDFSSDPSQDKEESQASASLPVIKKDNEQFQKL
AQQFASSAIFQGYGPLRHISNGGDLTDKNASYLVSYVKYFFDDYVVLEFLVKNKAQDQIL
KDVKVKLDLNNENIQVEKIVAATEIKEEEASNIFVALARNPEFKVIAFSSQCFLTFQVQD
IGANGKVISEYADEYQLDDVQVTISDHLTNWEIGKGKYETELNYLEGEVATQKFKLSYKS
IDFAIQEIIKHFSVSVCDGTNHIPQVQTEKFHTLKLAGKYLDKEKFLLSCMIAMDAKQGC
FLQMNVKSADEELNQDLINTFNN


>TTHERM_00444320(gene)
CTCATCTATAATTTTTTATTAGGAATTATATTGGTTATCAATAAATAAGTAAACAAATAA
AAAGCACGTATTTAGCAAAAGTTTAATCTGTTAAAGAAATGGCTCACCTCATTAAATAAG
TGTCAGAAAAATTCTAAAAGCTTCAAAATGATTTTAGGAGAAATACCATAGGTACCAACA
AACAAACAAATTAACTTCAATAACATTTAGAAAAATATTATTTTCAAATTCATTATTTTA
AGTTTATTAAGTATTACTCATTCATTATTAAGCTATGAAAAAGTGATATGCTTAATACAT
TTTTGAATTGGTTAATATGGAAAATGTTAAAATAAGAATTGTTTTTGTTAAATATAATAG
CTAAATATTTAGTTCTTATTTTCATTTTTAATAAAATTATTTAGAAGTAGATGCTTTTAG
TAAGATTAGCAAATCATAGGTCCTTTAAGATTGTAAGTAATTTACTAGCGTATAGTTAAA
CGATCGTTAATGCAGATAATTATTATCTCAATTAATCTATCTTATCAACTAAGTAATAAA
TAATATTATTTTTAGTAAAAAGATCAACATCAAAAATATTTTAGCTGTTATTTAAGATAA
TAAAACTGAATTTTCACCTAATAAATTTTGTCTTTGTTTTACTATTGATTTTTATAAAAA
TAGGGAAATAAGTTCAGTGATTAAGAGTAGTCAACTTTATTTTTCTAAGTTACAAGATTG
TTTTAATCAAACAACAAAGAATTACGTAGAATGGTCTACCTCATGATCAAAGTATTTAAT
CTTTAGCAATCTTATATAATTACTTATTTATTTATATAAATCAAAAAAACCTAAAAAATA
TAATATTTTGTTTATATAAATCCTTAATCAGGAATTCAAAGATGAAAAAATGGTCTATGT
TGTCACATAATCTTTGATGAAAGATATTACTTCTACTGTTGACTTATATAAGATGAATGC
TTTGAGAATTATTCCAGTTGTTTTAGATCCTTCTAATCTTATTTAAGTTGAACGCTACAT
CAAAAACGTAAAAAAAAATTATCTTATGACAATAAAAATATACTAATACTTTATATATAT
AATAAAAGGCTATTCTTGATAAAAATACTGCTGTAGCCAGTGCAGCTATATTGGCAGCCA
TATAATTATTCCCTTAACATAGTGAATCTATGAAAAAATTAAGCTCTGATGTAACTGCTG
CACTTCAAAACAATAAAACTTAATCCACAATCCATTTCCACGCCTAAATTCTACTTCATG
AAATAAAAAAATAAGATAGAAACTCATACATTAAGGTAATTACTTACAGTTTATATTCAT
TACTAAGGCCAATTAAAATTAACAAACAAATAGATTTTGCTTGAATAGACAAAGGATGCC
ATTGGCAACTCTGGCCACTTCTCTACTATTTAACTTATCAGATTTATCAAAGAAGTTCTC
TTAACATCTGAGTTGGATTAGACAACAGAAAGAACATTTATTGATTACTTAACAAGACAA
ACAAGTAAAACTAATGAAATGGTGACTATTGAAAGTTGCAAGGCTATTTGTGAACTTAAA
AATATCTCAAATAAAGATTTAACTCAACCAATAACAGTTTTGGGTATTTTCTTGGTTGGA
AGTAGCACAGTTAACAAATATGCTGCCTTGAAGATTATGAATAAGGTAAGTAATTCAATA
AGATTGATTTGTTTTAAAATATATTATTATTTAAAAAATATCATGAAAGCTTGTATCTAA
TCCTGCTAGAAAAGCTATCATCAACAATAAAACTGAAATACAATACCTTCTAACTGATAA
TAACAAGTAAAAATAATTACTTAACTTTCATATTTTTTAACATATATGTAAAAATATCTT
TTTAGGAGTATTTCTTCTTTAGCTGTTTCCATCTTGCTTAAATTGTGTAATGAAGATGAC
ATAGAGAGTTTGCTTAATTAAATTTATGATAATCTTTAAGACATGTCTGATGAATTTAAA
GTTGACATACTTAATTCTGTTAAAGGGCTTGTCAAATAACTTCCCAAAAAATATAGAATT
ATTTTAGTTTTCTTATTCAATTGTATGAAAAACGAAGGAAATGCTGATTTCAAAGCATAA
TGCATTGATGTTGTAGAAGATATTATTAGACAATTCCCTGCTGAAGAAGTTAGAGAATCT
AGTAAATTTAAAAATAAACCATGATTAAATCAATTAACTTATTAATTTAAAAAGGTTTAT
AGGTCTTATCTGAGTATATTGAAGATTGTTTAGTAAAAAGTTTATAATTAAAATGCTTGA
GCATTATCAACAAAGAGTCGTCCAAGAATACTGCTTCTCTTAAAATGATTAGACTTATTA
ACAACAGAATTCACTTAGAAGATTCTGAAGTAAGAGCTGCTGCTGTAGGTACTATTTCTA
AATTTGCATCAAAGCAATAATCTGTTAGAGAATAAGTTATCTAACTCTTGAAACAGTAAT
TTTAAAATTATAATAAATCTAAATTTTTATTTTTATTTATCTTTAACCAGTGCTTTGAGT
GATCCTGATGAAGAAGTCAGAGAAAGAGCATTCTAAAGTATTAATATTTTTAGTGAGCAA
GTTAGTTCTTTCTTAGAAGATAAAGCTAGAGAAGCTTCAACAATTGATTTCTAAGAAATT
ACATATATAGAAAAATATATTGAAATGAACAAGCAAAATATTGAAGAATCAGAAGATATT
GAAGCACTTTCCAAGGATAAAATATATGAATTTGCATAAGCATAAAATATTCAAGCAACA
TAAACTTCTGAAAATTAAGCATCAACAAATTATGATGATTTTTCATCTGATCCTTCTTAA
GACAAGGAAGAATCTTAAGCTTCTGCTAGTTTACCAGTTATTAAAAAGGATAATGAATAA
TTCTAAAAATTAGCACAATAATTTGCTTCCAGCGCTATTTTCTAAGGTTATGGACCTCTC
AGACATATTTCTAATGGAGGAGTAAATTATTTTGTTCAAATTCTTAAAAATACATTATTT
ATATTTCAAATCATAGGATCTTACTGACAAAAATGCTAGTTATTTAGTAAGCTATGTCAA
ATACTTCTTTGATGATTATGTTGTCTTAGAATTTTTAGTAAAAAACAAAGCTCAAGACCA
AGTAGGATATTTAAAGATATTTTATTAACAAAGGATTTTATGATTTTTAAACTTTAAATA
GATTCTTAAAGATGTGAAGGTTAAGTTAGATTTAAATAATGAAAACATTCAAGTAGAAAA
GATTGTTGCAGCCACTGAAATTAAAGAAGAAGAAGCAAGCAATATTTTTGTTGCTTTGGC
AAGAAACCCTGAATTTAAAGTTATTGCTTTCTCTAGCCAATGCTTCTTAACTTTCTAAGT
TTAAGATATAGGAGCTAATGGTAAAGTTATTTCTGAATATGCAGATGAATACTAACTAGA
TGATGTCTAAGTAACTATTTCCGATCATTTAACTAATTGGGAAATTGGTAAAGGAAAATA
CGAAACAGAATTAAATTATTTAGAAGGAGAAGTTGCTACATAAAAGTTTAAATTATCATA
CAAGAGTATTGATTTTGCTATCTAAGAAATTATTAAGCACTTCAGTAATAAAATTTATAT
TATCATAAAACATTTTGGTTACAATTTATTATGTAAACAGGTGTAAGCGTATGTGATGGA
ACAAATCACATTCCTCAAGTTCAAACAGAAAAATTCCATACTCTTAAACTAGCTGGTAAA
TACTTAGATAAAGAAAAGGTAATTTTATTAAATAAAATTTTGTAAAATCATTTTTAATTT
TTATTCTCACTTTTAAAAATTAAAAGTTCTTATTAAGCTGCATGATAGCTATGGATGCTA
AATAAGGTTGCTTCTTACAAATGAATGTTAAGAGCGCAGACGAAGAATTAAACTAAGATC
TTATAAATACTTTCAATAACTGAAAGTACTGTAATTTATTACTGATTTATTTGAAGATAG
ATGATATTAGTTTGATTAATTCACAAATTGTATGTTATCTCTTCATATTATAAATTTTGT
AAATTATAAAATAGTTTAAAAAAACTACAACCAAATCAAATTAAATTTATTTGAATAAAA
AATAAATAACATAAACGAACTAATGAATTAAAAGTGACAAGCAAAAATTTTTAATTTTAA
ATAAATTTTATTTCTTTTTTAAAACTAAATTTTTTATTTCTTGAAATAATTTTAAGAATT
TTTATATATTATTTATTTAATATTAAAATATGTATTTTTAACACATATTTTTATTTTGAA
TTATTAATTCAACCATTTCCTCTTCTTTTAGACAGACGCCAAGCTTCGTTATCACCACTT
TTAGTTGAGAGTGATTCAAGCTTTTCAGCCTTTTTAGCTTTTGATAATACATGAGGGTTT
ACGTTTTAAAAGAAATTCGGTGCAACTTCAACAAGCCACTTTGGTTCTATTGTGGAAATA
TTTCTCATATATTCTTTAGTTGTCAAAACTAATTCGTGATAAACTACCCAATCCGGCTGC
TTCTAAAAAAGTGCAGATGTAGGATGTATGTTAACAGTATGATTATCTATGATAGTTTTG
TATCCTTCGTTACGATCTTTTTTTGCTGCATGATTAAAGAAGCCTGCACATATAGCCTTA
CGGATTTTGGCATAATTTTTACCACACGATTAAACAGGTAAATGATAGCGGTCCATGATA
CCTATCAACTGTTTACGAATATCTTGTGCTCTTTTTATTGTTCTAGAATCTATGAAATTC
TCATGACACCAAATATTTGAAAAATTGTTTGATTTCCAAGCTTCGTATACAGTCAAAAGA
GTTAAGTGGTCTCCATCTTAATGATGAAATTTAGCACGACGCTGGTCAGCTTGTTATTTT
TTATCTTTTGGACAGAAAAATACATTTTAAACTGACAACATAGCAATAATAGTAGCTATT
TCATCTGAACATCCAAGATCAACACTTGTTATAAGCATTTTAGAGAGAGGTGGTTCTAAA
GGAAATTCGGCCATTTTCAAACCGAGACGTGTAAGGAGACCTTCATCATCCAAACAACCT
AAAGTGTAAAGATGTTCTAAAGCAGAAATCAAAGTTTGAATAGGAGGAGGATCCATAAAA
TCGAAGTTGATTAAATCATTAATACCCATTGCCTTTAAAAGTAAAACCGTGTTTGCTAAG
TTTGTACGCTGAATTTCAGGTATACTTGTTGGGAGCATTTCATTTTTGAAAGCATCTTCA
GTATAAAGACGGAAACATTTACCAGGACCTGTACGACCTGCACGACCCTAACGTTATTTC
GCTGAAGCCTATGAAATTGGTGCAACAATCAAGGAATCCATACCAAGTTTTGGATTGTAA
ACTTTAATTTTTGCAAATCCTGGATCTACGACATAGTAAATACCATCGATGGTAAGAGAT
GCTTCTGCAATATTAGTTGATATAATACATTTACGTTTTCCCTCAGGAGTAGGAAGGAAA
ATTCTATTCTATAGTTCATTAGGCAAACCAGCATAAAGAGGTAATATAATAAGTTCAGGT
GCATCTGGACCTAAGTTCTTCATACGCTAGAATAATATTTAGCATGCATTATCAATTTCT
TCTTGACCTGTTAAGAAAAGGAGAATATCGCCAGGAGGTTCATGCAAGTGAATTTGCATG
ATTACAATTAAAGAAGCTTCAACATAATCCTATTCAGGTTCTACAGAGTAGAGGACATCG
ACTTTGAAGGTACGACCTGGTACACGGAAAACTTAGCAATCAAAGAAATAATTAGAGAAT
TTTGCAGCATCAAGGGTAGCGGAAGTAATAATCAAATGAAAATCTTTTCTTTTCTTAGCT
ACTTTCTTAAGTAAACCAAAAAGAACATCTGTATTTAGCTATCTTTCATGTGCTTCATCG
AGCATAATAACTGAGTAGTTGCTTAGTTCTGTGTCAAGCAAGGCCTCACGAAGAAGCATA
CCATCAGTCATATATTTAATTACTGTAGAAGCAGATGTACAATCTTCAAAACGTATTGAA
TAACCTACTTCTTCACCAAGTACTACACCCATTTCTTCAGAAACACGCTTAGCAACACTC
ATAGCTGCAACACGACGAGGTTAGGTACACCCAATTTTCTTACCACTCTTACAAAAGCCT
GCTTCTAAGAGATACTATGTCATTTAAGTTGTTTTTCCTGAACCGGTTTCACCAATAACA
ATAAGAATTTAATTATTAATGCAAGCTTTGATAAGTTATTCCTTATATTAATAGATAGGA
AGAGATTCTTTTTACTCCTTGATTGTCATAGTTTATTTTGGTTTGTTAGAGTTGTTGAGA
GCAGCCTTAAACATTGCTTCTTTTTTAAATTCTGGAATTTCCGATGTTTAAGCATCTCCC
AACTTCTTTAAATTACTTAAAAGGAAAATAGATTCTGCAGTAGGATCTAAATTCATTTTT
TAGAGTTCTTATTTGTTAATACTATCTACCAAAGCATTGTTTTGCTAAATACGAATTTCT
CTTCTATCTTTTGCTTGTTAAACTGCATTAAGTGCTTGTCTACTCAAAGAGCCATTCTAG
TTTTTAGTAACTCTAATAGGAGATAAGTTTACTCCTGCCTTTGTTGTCGTATCTTTTAAG
AAGGGAGTTTCGTTCTCACGAATTTCAACTTCAACATCTTCATCTTCTGAACAACCTTCA
TCTAAATCTATTTCGCCTTTATCAATACCCAAATGTTTACTGGAATAGTATTCTGCTTAC
TTACGTTCCCACTTTTCTTAAGAACTTTCTCTGATTCTCTTTTTATTTTTTTCCTCTTTA
TCTTCAAGTAGAATACCTGTTAGAGCACCGAACTTTGAATTTTAATTTGATTTGATAATA
TCATCTTTATCTAACACACCAAATGCCTTCTTTTCTTTCTACTCAAGAGGGTCATACTTG
AGAGATTAGGATTCCTCATATCGTATTTTTTGTTCAAACTTATCTAAACCAGTTATTTAA
TCAACATCTTTCATACTCAAACTAATTTTGTTTCCTATCACACTTATTACTTTTACTTTT
ACTCTTTATCCAATTCTCGCTACTTCTTAAATATTTCCAACTCTTTTGCTTGAAAGCTAG
CTAATGTGAACCAAACCTTCTTTACGCCCTCCAACATTTTCTAATGTTACAAAACAACCA
AATTCACTTATTTTAGAAACAACTCCATCTAAAATTGAGTCCTTTTCAACTTCTTATCTC
TTGAATTGCTAACGAGTTTGCTTTTCTTATGATCTGCTGCGAGAACTATTTTCTCTACCC
TTTTTCTCTCTGAGTGGTGAATTCGAATCTCTCTAATATTTTTTTCTATGATCTTTTTTT
GCATCAGGGGAATCCCTTTTTTTCTTTTTTTCATGAGATTTAGAGCGTGAACGACGACTT
TTCTTTTCTTTTGAATAAGAGCGATTTTTTTTTTCTTTTGACCTACTTCTAGAGTATTTC
TTCTTACTTTTACCTTATGAGCGACTTCTAGACCTTCTTTTACTTTTTTCCTTTTTATGA
GACTTGCTTCTGCTTCTTGAATGCTTGCTACTTTTTTTTCTACTGATTTCTTTATTTGAA
GTCTCTTTTTCTTTTTCTTATCTTGCATCAATATTAGTCGGCTTTGGATCGAATTTACTA
CTATTTTTGTCCACTTTTTACTCTGGTTAAGGTTAATCCAGATCTATTTCATCTCTCTAT
GCAAGAGCTGGGAAAATTTTAGCATATTGCTTTCTCTTTTCTAGTTCTTGTCTTTTTAAT
TCATTCTATTCTTCATCACTATCTTCATTTTCATAATTTTCATCTCTTTTAACCTTTTCT
TTTTGCTTGATATCCTCTTTTTCGATTTCAATATCAATTTTTTATGGATCTCCTGCAGAA
AATTTATTTTTCTTGTCCTCAAGTTATTTATTTTATGCTTGAAGATCAACTTTCGGTTTA
ATTAAGCTCTACTTTGACTTAATCAATTTATATAAACTAGAAATAAATTAGTCTGATAAT
TCTGCATCATCTTTAATATTTTCAGCAAACTATTGCTCAGTATCTGATTCAAATGCTTAA
TCTATAAAATAATCTACTAAATCTTTATCCTAAATTCCTAGTTGTGTTTTCAGCTGTTGC
ATAACCTGCTAGCTGAGAAGGACATACTATAAATTAGAAGCCATTTCCCTTTTTTATATT
TATACAGATTAAAAAATAAATTAATTATTAAAAAATTTAAGTTTAGTGTCTAGTATGAAT
TAATAAAAATATAATAATCTTTTT