Identifiers and Description

Gene Model Identifier

g7602

Standard Name

APG2 (Adaptor Protein 1 complex Gamma subunit 2)

Aliases

None

Description

Coatomer subunit gamma-2; Adaptin AP-2 gamma subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?:

A PHP Error was encountered

Severity: Notice

Message: Trying to get property of non-object

Filename: feature/featureDetailsView.php

Line Number: 296

No
Presense Probability:

A PHP Error was encountered

Severity: Notice

Message: Trying to get property of non-object

Filename: feature/featureDetailsView.php

Line Number: 297

0%

TetraMine Data

g7602

WebApollo

A PHP Error was encountered

Severity: Notice

Message: Undefined variable: webapollo

Filename: feature/featureDetailsView.php

Line Number: 338

&tracks=DNA%2CmRNA%2Cgene%2CCDS%2Cexon">Fullscreen View

A PHP Error was encountered

Severity: Notice

Message: Undefined variable: webapollo

Filename: feature/featureDetailsView.php

Line Number: 340

&tracks=DNA%2CmRNA&nav=0&overview=0" width="700px" height="200px" type="text/html">

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>g7602(protein)
MAHLIKQVSEKFQKLQNDFRRNTIEVDAFSKISKSQVLQDCKQFTSVQLNDRQCRQLLSQ
LIYLINQGNKFSDQEQSTLFFQVTRLFQSNNKELRRMVYLMIKEFKDEKMVYVVTQSLMK
DITSTVDLYKMNALRIIPVVLDPSNLIQVERYIKNAILDKNTAVASAAILAAIQLFPQHS
ESMKKLSSDVTAALQNNKTQSTIHFHAQILLHEIKKQDRNSYIKILLEQTKDAIGNSGHF
STIQLIRFIKEVLLTSELDQTTERTFIDYLTRQTSKTNEMVTIESCKAICELKNISNKDL
TQPITVLGIFLVGSSTVNKYAALKIMNKLVSNPARKAIINNKTEIQYLLTDNNKSISSLA
VSILLKLCNEDDIESLLNQIYDNLQDMSDEFKVDILNSVKGLVKQLPKKYRIILVFLFNC
MKNEGNADFKAQCIDVVEDIIRQFPAEEVRESSLQVLSEYIEDCLVKSLQLKCLSIINKE
SSKNTASLKMIRLINNRIHLEDSEVRAAAVGTISKFASKQQSVREQVIQLLKHALSDPDE
EVRERAFQSINIFSEQVSSFLEDKAREASTIDFQEITYIEKYIEMNKQNIEESEDIEALS
KDKIYEFAQAQNIQATQTSENQASTNYDDFSSDPSQDKEESQASASLPVIKKDNEQFQKL
AQQFASSAIFQGYGPLRHISNGGDLTDKNASYLVSYVKYFFDDYVVLEFLVKNKAQDQIL
KDVKVKLDLNNENIQVEKIVAATEIKEEEASNIFVALARNPEFKVIAFSSQCFLTFQVQD
IGANGKVISEYADEYQLDDVQVTISDHLTNWEIGKGKYETELNYLEGEVATQKFKLSYKS
IDFAIQEIIKHFSVSVCDGTNHIPQVQTEKFHTLKLAGKYLDKEKFLLSCMIAMDAKQGC
FLQMNVKSADEELNQDLINTFNN


>g7602(coding)
ATGGCTCACCTCATTAAATAAGTGTCAGAAAAATTCTAAAAGCTTCAAAATGATTTTAGG
AGAAATACCATAGAAGTAGATGCTTTTAGTAAGATTAGCAAATCATAGGTCCTTTAAGAT
TGTAAGTAATTTACTAGCGTATAGTTAAACGATCGTTAATGCAGATAATTATTATCTCAA
TTAATCTATCTTATCAACTAAGGAAATAAGTTCAGTGATTAAGAGTAGTCAACTTTATTT
TTCTAAGTTACAAGATTGTTTTAATCAAACAACAAAGAATTACGTAGAATGGTCTACCTC
ATGATCAAAGAATTCAAAGATGAAAAAATGGTCTATGTTGTCACATAATCTTTGATGAAA
GATATTACTTCTACTGTTGACTTATATAAGATGAATGCTTTGAGAATTATTCCAGTTGTT
TTAGATCCTTCTAATCTTATTTAAGTTGAACGCTACATCAAAAACGCTATTCTTGATAAA
AATACTGCTGTAGCCAGTGCAGCTATATTGGCAGCCATATAATTATTCCCTTAACATAGT
GAATCTATGAAAAAATTAAGCTCTGATGTAACTGCTGCACTTCAAAACAATAAAACTTAA
TCCACAATCCATTTCCACGCCTAAATTCTACTTCATGAAATAAAAAAATAAGATAGAAAC
TCATACATTAAGATTTTGCTTGAATAGACAAAGGATGCCATTGGCAACTCTGGCCACTTC
TCTACTATTTAACTTATCAGATTTATCAAAGAAGTTCTCTTAACATCTGAGTTGGATTAG
ACAACAGAAAGAACATTTATTGATTACTTAACAAGACAAACAAGTAAAACTAATGAAATG
GTGACTATTGAAAGTTGCAAGGCTATTTGTGAACTTAAAAATATCTCAAATAAAGATTTA
ACTCAACCAATAACAGTTTTGGGTATTTTCTTGGTTGGAAGTAGCACAGTTAACAAATAT
GCTGCCTTGAAGATTATGAATAAGCTTGTATCTAATCCTGCTAGAAAAGCTATCATCAAC
AATAAAACTGAAATACAATACCTTCTAACTGATAATAACAAGAGTATTTCTTCTTTAGCT
GTTTCCATCTTGCTTAAATTGTGTAATGAAGATGACATAGAGAGTTTGCTTAATTAAATT
TATGATAATCTTTAAGACATGTCTGATGAATTTAAAGTTGACATACTTAATTCTGTTAAA
GGGCTTGTCAAATAACTTCCCAAAAAATATAGAATTATTTTAGTTTTCTTATTCAATTGT
ATGAAAAACGAAGGAAATGCTGATTTCAAAGCATAATGCATTGATGTTGTAGAAGATATT
ATTAGACAATTCCCTGCTGAAGAAGTTAGAGAATCTAGTTTATAGGTCTTATCTGAGTAT
ATTGAAGATTGTTTAGTAAAAAGTTTATAATTAAAATGCTTGAGCATTATCAACAAAGAG
TCGTCCAAGAATACTGCTTCTCTTAAAATGATTAGACTTATTAACAACAGAATTCACTTA
GAAGATTCTGAAGTAAGAGCTGCTGCTGTAGGTACTATTTCTAAATTTGCATCAAAGCAA
TAATCTGTTAGAGAATAAGTTATCTAACTCTTGAAACATGCTTTGAGTGATCCTGATGAA
GAAGTCAGAGAAAGAGCATTCTAAAGTATTAATATTTTTAGTGAGCAAGTTAGTTCTTTC
TTAGAAGATAAAGCTAGAGAAGCTTCAACAATTGATTTCTAAGAAATTACATATATAGAA
AAATATATTGAAATGAACAAGCAAAATATTGAAGAATCAGAAGATATTGAAGCACTTTCC
AAGGATAAAATATATGAATTTGCATAAGCATAAAATATTCAAGCAACATAAACTTCTGAA
AATTAAGCATCAACAAATTATGATGATTTTTCATCTGATCCTTCTTAAGACAAGGAAGAA
TCTTAAGCTTCTGCTAGTTTACCAGTTATTAAAAAGGATAATGAATAATTCTAAAAATTA
GCACAATAATTTGCTTCCAGCGCTATTTTCTAAGGTTATGGACCTCTCAGACATATTTCT
AATGGAGGAGATCTTACTGACAAAAATGCTAGTTATTTAGTAAGCTATGTCAAATACTTC
TTTGATGATTATGTTGTCTTAGAATTTTTAGTAAAAAACAAAGCTCAAGACCAAATTCTT
AAAGATGTGAAGGTTAAGTTAGATTTAAATAATGAAAACATTCAAGTAGAAAAGATTGTT
GCAGCCACTGAAATTAAAGAAGAAGAAGCAAGCAATATTTTTGTTGCTTTGGCAAGAAAC
CCTGAATTTAAAGTTATTGCTTTCTCTAGCCAATGCTTCTTAACTTTCTAAGTTTAAGAT
ATAGGAGCTAATGGTAAAGTTATTTCTGAATATGCAGATGAATACTAACTAGATGATGTC
TAAGTAACTATTTCCGATCATTTAACTAATTGGGAAATTGGTAAAGGAAAATACGAAACA
GAATTAAATTATTTAGAAGGAGAAGTTGCTACATAAAAGTTTAAATTATCATACAAGAGT
ATTGATTTTGCTATCTAAGAAATTATTAAGCACTTCAGTGTAAGCGTATGTGATGGAACA
AATCACATTCCTCAAGTTCAAACAGAAAAATTCCATACTCTTAAACTAGCTGGTAAATAC
TTAGATAAAGAAAAGTTCTTATTAAGCTGCATGATAGCTATGGATGCTAAATAAGGTTGC
TTCTTACAAATGAATGTTAAGAGCGCAGACGAAGAATTAAACTAAGATCTTATAAATACT
TTCAATAACTGA


>g7602(gene)
ATGGCTCACCTCATTAAATAAGTGTCAGAAAAATTCTAAAAGCTTCAAAATGATTTTAGG
AGAAATACCATAGGTACCAACAAACAAACAAATTAACTTCAATAACATTTAGAAAAATAT
TATTTTCAAATTCATTATTTTAAGTTTATTAAGTATTACTCATTCATTATTAAGCTATGA
AAAAGTGATATGCTTAATACATTTTTGAATTGGTTAATATGGAAAATGTTAAAATAAGAA
TTGTTTTTGTTAAATATAATAGCTAAATATTTAGTTCTTATTTTCATTTTTAATAAAATT
ATTTAGAAGTAGATGCTTTTAGTAAGATTAGCAAATCATAGGTCCTTTAAGATTGTAAGT
AATTTACTAGCGTATAGTTAAACGATCGTTAATGCAGATAATTATTATCTCAATTAATCT
ATCTTATCAACTAAGTAATAAATAATATTATTTTTAGTAAAAAGATCAACATCAAAAATA
TTTTAGCTGTTATTTAAGATAATAAAACTGAATTTTCACCTAATAAATTTTGTCTTTGTT
TTACTATTGATTTTTATAAAAATAGGGAAATAAGTTCAGTGATTAAGAGTAGTCAACTTT
ATTTTTCTAAGTTACAAGATTGTTTTAATCAAACAACAAAGAATTACGTAGAATGGTCTA
CCTCATGATCAAAGTATTTAATCTTTAGCAATCTTATATAATTACTTATTTATTTATATA
AATCAAAAAAACCTAAAAAATATAATATTTTGTTTATATAAATCCTTAATCAGGAATTCA
AAGATGAAAAAATGGTCTATGTTGTCACATAATCTTTGATGAAAGATATTACTTCTACTG
TTGACTTATATAAGATGAATGCTTTGAGAATTATTCCAGTTGTTTTAGATCCTTCTAATC
TTATTTAAGTTGAACGCTACATCAAAAACGTAAAAAAAAATTATCTTATGACAATAAAAA
TATACTAATACTTTATATATATAATAAAAGGCTATTCTTGATAAAAATACTGCTGTAGCC
AGTGCAGCTATATTGGCAGCCATATAATTATTCCCTTAACATAGTGAATCTATGAAAAAA
TTAAGCTCTGATGTAACTGCTGCACTTCAAAACAATAAAACTTAATCCACAATCCATTTC
CACGCCTAAATTCTACTTCATGAAATAAAAAAATAAGATAGAAACTCATACATTAAGGTA
ATTACTTACAGTTTATATTCATTACTAAGGCCAATTAAAATTAACAAACAAATAGATTTT
GCTTGAATAGACAAAGGATGCCATTGGCAACTCTGGCCACTTCTCTACTATTTAACTTAT
CAGATTTATCAAAGAAGTTCTCTTAACATCTGAGTTGGATTAGACAACAGAAAGAACATT
TATTGATTACTTAACAAGACAAACAAGTAAAACTAATGAAATGGTGACTATTGAAAGTTG
CAAGGCTATTTGTGAACTTAAAAATATCTCAAATAAAGATTTAACTCAACCAATAACAGT
TTTGGGTATTTTCTTGGTTGGAAGTAGCACAGTTAACAAATATGCTGCCTTGAAGATTAT
GAATAAGGTAAGTAATTCAATAAGATTGATTTGTTTTAAAATATATTATTATTTAAAAAA
TATCATGAAAGCTTGTATCTAATCCTGCTAGAAAAGCTATCATCAACAATAAAACTGAAA
TACAATACCTTCTAACTGATAATAACAAGTAAAAATAATTACTTAACTTTCATATTTTTT
AACATATATGTAAAAATATCTTTTTAGGAGTATTTCTTCTTTAGCTGTTTCCATCTTGCT
TAAATTGTGTAATGAAGATGACATAGAGAGTTTGCTTAATTAAATTTATGATAATCTTTA
AGACATGTCTGATGAATTTAAAGTTGACATACTTAATTCTGTTAAAGGGCTTGTCAAATA
ACTTCCCAAAAAATATAGAATTATTTTAGTTTTCTTATTCAATTGTATGAAAAACGAAGG
AAATGCTGATTTCAAAGCATAATGCATTGATGTTGTAGAAGATATTATTAGACAATTCCC
TGCTGAAGAAGTTAGAGAATCTAGTAAATTTAAAAATAAACCATGATTAAATCAATTAAC
TTATTAATTTAAAAAGGTTTATAGGTCTTATCTGAGTATATTGAAGATTGTTTAGTAAAA
AGTTTATAATTAAAATGCTTGAGCATTATCAACAAAGAGTCGTCCAAGAATACTGCTTCT
CTTAAAATGATTAGACTTATTAACAACAGAATTCACTTAGAAGATTCTGAAGTAAGAGCT
GCTGCTGTAGGTACTATTTCTAAATTTGCATCAAAGCAATAATCTGTTAGAGAATAAGTT
ATCTAACTCTTGAAACAGTAATTTTAAAATTATAATAAATCTAAATTTTTATTTTTATTT
ATCTTTAACCAGTGCTTTGAGTGATCCTGATGAAGAAGTCAGAGAAAGAGCATTCTAAAG
TATTAATATTTTTAGTGAGCAAGTTAGTTCTTTCTTAGAAGATAAAGCTAGAGAAGCTTC
AACAATTGATTTCTAAGAAATTACATATATAGAAAAATATATTGAAATGAACAAGCAAAA
TATTGAAGAATCAGAAGATATTGAAGCACTTTCCAAGGATAAAATATATGAATTTGCATA
AGCATAAAATATTCAAGCAACATAAACTTCTGAAAATTAAGCATCAACAAATTATGATGA
TTTTTCATCTGATCCTTCTTAAGACAAGGAAGAATCTTAAGCTTCTGCTAGTTTACCAGT
TATTAAAAAGGATAATGAATAATTCTAAAAATTAGCACAATAATTTGCTTCCAGCGCTAT
TTTCTAAGGTTATGGACCTCTCAGACATATTTCTAATGGAGGAGTAAATTATTTTGTTCA
AATTCTTAAAAATACATTATTTATATTTCAAATCATAGGATCTTACTGACAAAAATGCTA
GTTATTTAGTAAGCTATGTCAAATACTTCTTTGATGATTATGTTGTCTTAGAATTTTTAG
TAAAAAACAAAGCTCAAGACCAAGTAGGATATTTAAAGATATTTTATTAACAAAGGATTT
TATGATTTTTAAACTTTAAATAGATTCTTAAAGATGTGAAGGTTAAGTTAGATTTAAATA
ATGAAAACATTCAAGTAGAAAAGATTGTTGCAGCCACTGAAATTAAAGAAGAAGAAGCAA
GCAATATTTTTGTTGCTTTGGCAAGAAACCCTGAATTTAAAGTTATTGCTTTCTCTAGCC
AATGCTTCTTAACTTTCTAAGTTTAAGATATAGGAGCTAATGGTAAAGTTATTTCTGAAT
ATGCAGATGAATACTAACTAGATGATGTCTAAGTAACTATTTCCGATCATTTAACTAATT
GGGAAATTGGTAAAGGAAAATACGAAACAGAATTAAATTATTTAGAAGGAGAAGTTGCTA
CATAAAAGTTTAAATTATCATACAAGAGTATTGATTTTGCTATCTAAGAAATTATTAAGC
ACTTCAGTAATAAAATTTATATTATCATAAAACATTTTGGTTACAATTTATTATGTAAAC
AGGTGTAAGCGTATGTGATGGAACAAATCACATTCCTCAAGTTCAAACAGAAAAATTCCA
TACTCTTAAACTAGCTGGTAAATACTTAGATAAAGAAAAGGTAATTTTATTAAATAAAAT
TTTGTAAAATCATTTTTAATTTTTATTCTCACTTTTAAAAATTAAAAGTTCTTATTAAGC
TGCATGATAGCTATGGATGCTAAATAAGGTTGCTTCTTACAAATGAATGTTAAGAGCGCA
GACGAAGAATTAAACTAAGATCTTATAAATACTTTCAATAACTGA