Identifiers and Description

Gene Model Identifier

TTHERM_00287890

Standard Name

APG11 (gamma chain of AP-1 adaptor protein complex)

Aliases

PreTt25920 | 26.m00272 | 3688.m00066

Description

Adaptin N terminal region family protein; gamma subunit of AP-1 complex

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF02985 ) HEAT repeat
  • ( PF01602 ) Adaptin N terminal region
  • ( PF02883 ) Adaptin C-terminal domain
  • ( PF01814 ) Hemerythrin HHE cation binding domain
  • ( TIGR02549 ) CRISPR-associated DxTHG motif protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00287890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09298.19.997093137033517e-262adaptin N-terminal region fami
ly protein (895 aa)
DictyBaseDDB_G02819575.001257666360868e-155ap1g1 on chromosome: 3 positio
n 5194623 to 5197502
OxytrichaContig11604.0.g351.0001043265246556e-154Adaptin N terminal region
WormBaseWBGene000001589.997962730346853e-122locus:apg-1 status:Partially
_confirmed UniProt:Q8WQB3
protein_id:CAD21660.1
Stentor CoeruleusSteCoe_181731.4411565509640892e-64
SGDYPR029C1.9990871925214856e-61APL4 Gamma-adaptin, large subu
nit of the clathrin-associated
protein (AP-1) complex; binds
clathrin; involved in vesicle
mediated transport

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00287890(coding)
ATGAGTATTAGCAAGCCAGGAGAGGGAGCTACTAAATAACACCCTTTACATGAGTTTAAA
GATATTATAAAGCAAGTGAGGGAATGTAAAACAGCTGCATAGGAAAGAGAGTTAATCAAT
AAGGAAAAAGCTCTAATTAGAGAAAGATTCCTGTAAAATAAAGAAGAAACAAGAGCAAAG
GATGTAGCTAAATTGCTTTACATATCTATGTTAGGTCATAACACAGATTTTGGTTAAATG
GAATGCCTTAAATTGATTACTTCTTCAAATTATGGAAATAAAAGAATTGGGTACTTAGGT
CTCTGTTAACTTTTCCATGAACATTCTGAAATATTAATGTTGGCCACTAATAGAATTCAT
ATTGACTTAAATCACACTAATAATTACGTTATTAGTTTAGCTATTGTAGCTTTAAATGAA
ATTTGCACTACAGAAATGTGTAGAGAGTTGATTCCAGATCTTATGAAGCAATTCTAAGTT
GGATCAACTTTTATTAAAAAGAAAGTAGCATTATGTTGTATTAAAATGGTTAAAAAGTTA
CCTGAAGCAACTTCCGATATAGTATAATAAATAGATAGCTTGATGGAGGATAAGCATCAT
GGTGTGCTATTAAGTACTGTCTCTTTAATGAAATCTTTAGTTGTTTTAAACGAAGAAAAT
AAAAACTATTTCTATAAGCATATTACTCCTTTGAAAAAAATACTGAAAGCTCTTATTAGT
AATATGAGTGCAGAATTTGATGTAAATGGAGTTAATGACCCATTTTTGTAAATTTCTATT
TTAGAATTCTTCAGAATGATGGCTTAAGGAAAGCAACACGTAGCAGATGAAATTAGTGGT
ATATTGGGAGAGGTTGCCTCAAATACAAATGGAGATAAAAATAGTGGAAGTGCTGTATTA
TATGAATGTGTAAAGACAGTTATGGAGATAGGCAGTACTAGCTCGTTAAAAATATTATGC
ATAAATGTATTGGGAAAGTTCTTAAAAAACGCAGAACCAAACATTAAATATGTTTCTCTC
TTTATGCTATAGAAAGTTTTGAATTACGATCTAAAAACTGTTTAGAAATATATGTAAACA
ATTATTTAATGCTTAAAGGAAGAAGATATTTCAATTAAGCAACTTGCATTAGATTTGATT
TTTATGGTCTCTTCAAGTGAGAATGTAGAGAGTATTATTAAAGAATTACTGAATCATATG
ATGGATCCTGAACAACTAATTTTCTTACCAGAACTAGTTTTAAAGACTTGCATGATTATA
GATTCTCACGCACCTAATAGAAGATGGCAAATTGATACTATCATCAAAGTGCTCAGTTTA
GCTGGTAGCTACGCCAAAGAAGATACTACTAACAATTTAATTAATCTAATATCTGTTTCT
CCTAGTTTGTAATAGTATGCTGTATAAAAATTATATTTTGCACTTAAACAGAAAATTGAT
TAGTCAGGCTTGGCAGTTGTCTCTTTATACTGTTTTGGTGAGTATGGCCATAAATTAGTA
ACAGCCACTCAAGGCTCAGAAGACTCAATTAGTGAAAAAGATGTATATGACCTTATCTCT
AAAGTTTTTGAAAAGTATGTTGAAAATGATGACGTAAAAGAATATGGCATGAACTGCTTA
ATGAAATTATTCTATAAGTTCACTAGTTTAACTTTAGAAAATTATGTAAACATTTTAAAC
CCATTAACTACATCAACAACCCCAGAAGTTCAGAAGAGAGCCTGTGAATATTTGCATATA
ATTTAAAATGAATGGAAAAATTAAGTTCATTATATCTTTTAAACTAATCCTGAATATTCA
AAAGCTACCTAACAGTTTTCTAAAAAGCCTGTCGATGAGTAAAGCTAAAAAAAGCAAACA
AATTTATTGGAAGATGATGAAATTCCTCAAACTCCAGTAAGTTAAGCACAAACTGCTTAA
CAAAATATCTTAGACGATTTGATTGGAGGTACTAGTACAGCTAATAATGTGCCAACAACT
TCATCTATTTAGGGAGAATAGAATGGTATAGATTTATTAAATGATATAATAGGTGGAACT
TCATACACACCTTCAGCTCAAAATGATAACAAAATATAAAAAAATCTAATTACTGACTTA
CTTGATGATTTACCTTCCCAAAGCTAGAACTAATAAATTTCTTAAAGTAATACACAGGCT
TAAAAAGAGAAAAATAATGAGCAATAACAATCTAAAAACTTAATTGATTTACTCGGTGGA
GACGAAGAAATAACAACTACTCCCATCTCTAATCAAAAAATAACCTCAAACAATAATTTT
GATGACTTTGGAGAAATGCAAGTCAGCTAGCCAGTTTTACCAAAACACATATTTACAGCT
ATCGAAGATGCAACTATTAAGATTGTTTTTAAATGCACTAAGCAATCTGCAGATACTGTT
GAGATCACTATAGAGTATGGAAATAAGACTCCATTTATTATAAATGAACTTTAGTTCTAA
GTAGCTGTTCAAAAGCATAATAAACTAACAATGAATCCTATATCATCTACCCAGATACCT
CCTAATTCCTCAAGTGAAACAGTTTAAGTAATGAGTGTTGTTAATACAATGGCAGGGCAA
AAAAGCATAGCTATGAAGGTCCGTCTTCAATATAATATAAATGGAAAGCCAGTAGCACTA
GACAGTCTTGTATAAGATTTCCCCAAGGGATGGTGA


>TTHERM_00287890(protein)
MSISKPGEGATKQHPLHEFKDIIKQVRECKTAAQERELINKEKALIRERFLQNKEETRAK
DVAKLLYISMLGHNTDFGQMECLKLITSSNYGNKRIGYLGLCQLFHEHSEILMLATNRIH
IDLNHTNNYVISLAIVALNEICTTEMCRELIPDLMKQFQVGSTFIKKKVALCCIKMVKKL
PEATSDIVQQIDSLMEDKHHGVLLSTVSLMKSLVVLNEENKNYFYKHITPLKKILKALIS
NMSAEFDVNGVNDPFLQISILEFFRMMAQGKQHVADEISGILGEVASNTNGDKNSGSAVL
YECVKTVMEIGSTSSLKILCINVLGKFLKNAEPNIKYVSLFMLQKVLNYDLKTVQKYMQT
IIQCLKEEDISIKQLALDLIFMVSSSENVESIIKELLNHMMDPEQLIFLPELVLKTCMII
DSHAPNRRWQIDTIIKVLSLAGSYAKEDTTNNLINLISVSPSLQQYAVQKLYFALKQKID
QSGLAVVSLYCFGEYGHKLVTATQGSEDSISEKDVYDLISKVFEKYVENDDVKEYGMNCL
MKLFYKFTSLTLENYVNILNPLTTSTTPEVQKRACEYLHIIQNEWKNQVHYIFQTNPEYS
KATQQFSKKPVDEQSQKKQTNLLEDDEIPQTPVSQAQTAQQNILDDLIGGTSTANNVPTT
SSIQGEQNGIDLLNDIIGGTSYTPSAQNDNKIQKNLITDLLDDLPSQSQNQQISQSNTQA
QKEKNNEQQQSKNLIDLLGGDEEITTTPISNQKITSNNNFDDFGEMQVSQPVLPKHIFTA
IEDATIKIVFKCTKQSADTVEITIEYGNKTPFIINELQFQVAVQKHNKLTMNPISSTQIP
PNSSSETVQVMSVVNTMAGQKSIAMKVRLQYNINGKPVALDSLVQDFPKGW


>TTHERM_00287890(gene)
ATGAGTATTAGCAAGCCAGGAGAGGGAGCTACTAAATAACACCCTTTACATGAGTTTAAA
GATATTATAAAGCAAGTGAGGGAATGTAAAACAGCTGCATAGGAAAGAGAGTTAATCAAT
AAGGAAAAAGCTCTAATTAGAGAAAGATTCCTGGTATGATTACAATCATATTAAATTTAA
AAAGATAAATAAATTATGTATTTTTAAACTACTATAAGCAATTGAATTGCAACTAATAAA
TAAAATTATTTTTTATATCCAAAGCTAATTTAGCTTATCTAATATGTTATTCGATTATTT
AAAATTAAAGTAAAATAAAGAAGAAACAAGAGCAAAGGATGTAGCTAAATTGCTTTACAT
ATCTATGTTAGGTCATAACACAGATTTTGGTTAAATGGAATGCCTTAAATTGATTACTTC
TTCAAATTATGGAAATAAAAGAATTGGGTACTTAGGTCTCTGTTAACTTTTCCATGAACA
TTCTGAAATATTAATGTTGGCCACTAATAGAATTCATATTGACTTAAATCACACTGTAAA
TTTTTATAATAATTCTTAATGCAAAAAAAAACATTAAAACAATAGAATTATGACTAAATT
ATAAGAAAATTTAATTTTAAAGCGAAAATAAATTATTTTATTAAAATATCTAGAATAATT
ACGTTATTAGTTTAGCTATTGTAGCTTTAAATGAAATTTGCACTACAGAAATGTGTAGAG
AGTTGATTCCAGATCTTATGAAGCAATTCTAAGTTGGATCAACTTTTATTAAAAAGAAAG
TAGCATTATGTTGTATTAAAATGGTTAAAAAGTTACCTGAAGCAACTTCCGATATAGTAT
AATAAATAGATAGCTTGATGGAGGATAAGCATCATGGTAAACTATATTTCTTAAAATTTA
GTTTTTGGCATTCTTTCTAAAATAAGATATTAATAAACATTTACAAAAATTAAATAAAAT
TATTGATTTCAAATTAAAATTTGTAGCATTTTTTTAAAGCATTCACAAATAAGTTGAAAA
TTCAATAATATCATTTTATAGAAATATAATGCAATTATTTTATTAAAATCAAAATTTTTT
AAATAAAATTTGAAATAATTAAATGTATTTATTTAATAGCTGATTATAAGAAGTTTAATC
TATTTTTGATATAATTTATTATGAAATAATCTTAATGCAAATAAAAAAAATACTTTTTTA
TTTTAAAAACTTTATTAAATCTAAAAGAATTTGGTGAAAGAAGAAAATTATTTTAATTGA
TTTTGGAATAAATTTTACAATATTTAAAAATTTTGTCTAATTTTTATTTATTATATAATA
TTATTCTTATAAATTATTTGAAAAACTTATTAGGTGTGCTATTAAGTACTGTCTCTTTAA
TGAAATCTTTAGTTGTTTTAAACGAAGAAAATAAAAACTATTTCTATAAGCATATTACTC
CTTTGAAAAAAATACTGAAAGCTCTTATTAGTAATATGAGTGCAGAATTTGATGTAAATG
GAGTTAATGACCCATTTTTGTAAATTTCTATTTTAGAATTCTTCAGAATGATGGCTTAAG
GAAAGCAACACGTAGCAGATGAAATTAGTGGTATATTGGGAGAGGTAAATTTAAAATGGT
TTTACTTTAGAAAACTTTTTTATCATTTTCAATTTTAATTGAGATTATTTTTAAAAAATA
CATTTTTGAAATAAAAAACTTTTACAATTTAAATTTACAACAATTATTTTTTAACAAAAA
AGGTTGCCTCAAATACAAATGGAGATAAAAATAGTGGAAGTGCTGTATTATATGAATGTG
TAAAGACAGTTATGGAGATAGGCAGTACTAGCTCGTTAAAAATATTATGCATAAATGTAT
TGGGAAAGTTCTTAAAAAACGCAGAACCAAACATTAAATATGTTTCTCTCTTTATGCTAT
AGAAAGTTTTGAATTACGATCTAAAAACTGTTTAGAAATATATGTAAACAATTATTTAAT
GCTTAAAGGAAGAAGATATTTCAATTAAGCAACTTGCATTAGATTTGATTTTTATGGTCT
CTTCAAGTGAGAATGTAGAGAGTATTATTAAAGAATTACTGAATCATATGATGGATCCTG
AACAACTAATTTTCTTACCAGAACTAGTTTTAAAGGTTAGAATTATTTTTGAAAGCAGCC
TAAATTTTTACAAAAAAACACTTGTTTTTCTATCTTTTTTTACTTAAAATAGAAAATATC
TTGTTTATTACTTAATTAATTTTCAGAATCGAATTATTTTTAAGTAAAATATTAAATATT
TTTCTATAATTATAAAAAGACTTGCATGATTATAGATTCTCACGCACCTAATAGAAGATG
GCAAATTGATACTGTAAGCTATAACTAAAAAATTTTTAATTATTTTCTAAAATTAATTAC
AATAATAAATAGATCATCAAAGTGCTCAGTTTAGCTGGTAGCTACGCCAAAGAAGATACT
ACTAACAATTTAATTAATCTAATATCTGTTTCTCCTAGTTTGTAATAGTATGCTGTATAA
AAATTATATTTTGCACTTAAACAGAAAATTGATTAGTCAGGCTTGGCAGTTGTCTCTTTA
TACTGTTTTGGTGAGTATGGCCATAAATTAGTAACAGCCACTCAAGGCTCAGAAGACTCA
ATTAGTGAAAAAGATGTATATGACCTTATCTCTAAAGTTTTTGAAAAGTATGTTGAAAAT
GATGACGTAAAAGAATATGGCATGAACTGCTTAATGAAATTATTCTATAAGTTCACTAGT
TTAACTTTAGAAAATTATGTAAACATTTTAAACCCATTAACTACATCAACAACCCCAGAA
GTTCAGAAGAGAGCCTGTGAATATTTGCATATAATTTAAAATGAATGGAAAAATTAAGTT
CATTATATCTTTTAAACTAATCCTGAATATTCAAAAGCTACCTAACAGTTTTCTAAGTAA
TATTTAGATTTAATTTATTTACACTATTATTTCCTCTGAAATTTTAATTCAATTTTCCTT
ATTTTGAAATATCTATCTGATATTTAACTCATTAATTTATTCAAGTGCTTAAGCAAAATA
TCTATGACTTTTTAAAAAGGAGTAAATAAACAAAAAAAATAATTTAAATTTATAAATAAA
TTTTTTTTGTTATCTATTCTACTTTAATTAAAACTGAGTTTGATAGAACATTTTTTATTT
TGTTATATTTCTTACAAAAAGATATTTAATGATTTGAAATATATCGAATATTAAATTACG
TATTTATTTAATAGAAAGCCTGTCGATGAGTAAAGCTAAAAAAAGCAAACAAATTTATTG
GAAGATGATGAAATTCCTCAAACTCCAGTAAGTTAAGCACAAACTGCTTAACAAAATATC
TTAGACGATTTGATTGGAGGTACTAGTACAGCTAATAATGTGCCAACAACTTCATCTATT
TAGGGAGAATAGAATGGTATAGATTTATTAAATGATATAATAGGTGGAACTTCATACACA
CCTTCAGCTCAAAATGATAACAAAATATAAAAAAATCTAATTACTGACTTACTTGATGAT
TTACCTTCCCAAAGCTAGAACTAATAAATTTCTTAAAGTAATACACAGGCTTAAAAAGAG
AAAAATAATGAGCAATAACAATCTAAAAACTTAATTGATTTACTCGGTGGAGACGAAGAA
ATAACAACTACTCCCATCTCTAATCAAAAAATAACCTCAAACAATAATTTTGATGACTTT
GGAGAAATGCAAGTCAGCTAGCCAGTTTTACCAAAACACATATTTACAGCTATCGAAGAT
GCAACTATTAAGATTGTTTTTAAATGCACTAAGGTAAAATCTTAAAAATATTTTGAATAG
ACTCTAGTTTTTAACAGATTTTAATTACTTAATCTCCTCACTTAATTACTTATTTTAGCA
TTCTATATTAACCTCATCAAATTAAATAAACCTAACCCTAAAGTAGTTCTAGTGATTTTT
AATTTTAGGGGTATTTCACAAATTATCCTCTTATTTCTTATTATATTGTTACATACAATT
TAATTAGAAATACTTCATATTGAATACTTAGTACTTTATTTTCTTTTATATAAAAAACTA
TTTCTGCCCTAATACAAATCAATTAAAATAATTAGTCGGAAATTTTATCTAAAAAATATT
TTAAATTTTTATAATTTGATCTTCTGATTTTTTATTGTTAATATTCTATATTTTAAAATA
AAGCAATCTGCAGATACTGTTGAGATCACTATAGAGTATGGAAATAAGACTCCATTTATT
ATAAATGAACTTTAGTTCTAAGTAGCTGTTCAAAAGCATAATAAACTAACAATGAATCCT
ATATCATCTACCCAGATACCTCCTAATTCCTCAAGTGAAACAGTTTAAGTAAGGATTTAA
ATAATCATAAATTTTTTATATATTAATTGCAACAAAAAAATCTCTATTACTAAAATATTC
TCTTTACCAAATTTGATTAAAAATACAATCAAATTTATCAGCTTTGACTTATCCATTTAC
TTTGTTCTGTAACCAAATTATGAATTAATTTATTTGAGTGATTGAGATGTATTTTATAAA
ACTATAAGAATCTTTCGTATTAATATCCACGAAAATAAAATCCAAGAATGTTAATTAAAG
CAATTTATAACCACAAATTAAATTAAATATCAATGTTTCTTTGAGAAAAGCTAATTTAAA
ACTAAAATGTATGCCCATCAAAATTGCTTAATAAAGGAAAAAATTTATCAAATGTTAAAA
TTTAGAAAAATACTTAAAAAAAAAATTGAGAATTTAATTTTTCTTATTTTATTTAAACCT
TTTAAATGTATTAATTTTTTTTTGAATTTTATCAGCAAAGAAATTGCTAGTTACTTGGAA
ATTTATTCTTACTAAACTAAATATATTTTAACAGAAATAACTAAAAATATAACAAATTTT
TTATAAAAAATAATAACAATATAGGTAATGAGTGTTGTTAATACAATGGCAGGGCAAAAA
AGCATAGCTATGAAGGTCCGTCTTCAATATAATATAAATGGAAAGCCAGTATACATTCTC
ATTTTTATTTTTTAGATTACTAAAATATTAAAATAATAATTTAAAGGTAGCACTAGACAG
TCTTGTATAAGATTTCCCCAAGGGATGGTGA