Identifiers and Description

Gene Model Identifier

TTHERM_00715750

Standard Name

APG1 (gamma subunit of adaptin 1 (AP-1) complex)

Aliases

PreTt19049 | 113.m00088 | 3673.m00012

Description

AP-1 adaptor complex, gamma subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01602 ) Adaptin N terminal region
  • ( PF02883 ) Adaptin C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00715750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16846.19.997093137033517e-262adaptin N-terminal region fami
ly protein (874 aa)
OxytrichaContig11604.0.g359.997093137033517e-262Adaptin N terminal region
DictyBaseDDB_G02819573.9990262819827913e-171ap1g1 on chromosome: 3 positio
n 5194623 to 5197502
WormBaseWBGene000001581.99904246446894e-143locus:apg-1 status:Partially
_confirmed UniProt:Q8WQB3
protein_id:CAD21660.1
Stentor CoeruleusSteCoe_363559.964733010103672e-77
SGDYPR029C1.9997677415930956e-65APL4 Gamma-adaptin, large subu
nit of the clathrin-associated
protein (AP-1) complex; binds
clathrin; involved in vesicle
mediated transport

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00715750(coding)
ATGAGTAAAGAAGTTCCTTAAAAGCTTAGAGATTTAATCAAGGCTATTAGAGGCTGCAAA
ACTACAGCCGAAGAAAGAGCTTTAGTATAAAAGGAGAAGGCATTGATTCGTGAATCATTT
AATAAAAATGAAGAGGAATATAGACCAAGAAATGTAGCAAAATTGCTTTTTATCAATATG
TTAGGTCACAACACTGATTTCGGTCAAATGGAATGTTTGAAACTCATTTCTGCTTAGTCT
TTCACAGAAAAGAGAATAGGTTATTTAGGACTTACTTAACTTTTCCATGAATAGTCTGAT
GTATTATTGATGGCAACTTCACGTCTCCTTACAGATTTATAAAGTTAAAATAATTATGTA
GCAAGTTTAGCAATTATTGCAGTTAGCGAAATATGTACAACTGATATGTGTAGAGAACTT
ATAGGTAATATACTTAAAATCATGCAAAGTGGTACTTCTTTCACAAGAAAAAAAGCTCCA
CTTGCTGCTGCTAAAATTATGAAAAAGTTGCCTGATCATTTACCTGATATTATTGAAAAA
ATTAACACCCTTATGGAAGATCGTCACCATGGTGTTTTGATAGCAACTCTTGGTTTGATT
GAAGAAATTATTTTACATGATCCTACAACCAAGGATAAATTCAAAAAATACGTCACTCCC
ATGATTAAAGTTCTTTAAGGTTTGGTGTCTCATTACGATAAAGATTTTGAAATTGCTGGT
GTGGTTGATCCTTTCTTATAAATGAAGATCTTGAAATTCTTCAGATACATGGGTAAAGGA
GATACTACAGTTTCTGAAGAAGTTTCTAATGTCCTCGCATCAGTTTCTAGTAATACCAAC
AGTTCTAAAAACACAGGTAATGCTGTTCTCTATGAATGTGTGCAAACAATTATGGAAATT
GAAAGTTCTAGTCATTTAAAAACATTAGGTATTAACATTTTAGGTAAATTCTTAAGCTAA
AAGGATTACAATAGCAAGTATTGTGCTTTATTCATGTTAAAGCAAGTTGTTAATCATGAT
ATTAATGCTGTCTAAAAGCACAAATAAACTATTCTAGATTGTATGAAAGAAAGTGATATT
TCTGTCAAGCAGTTAGCTTTAGATTTAGTTTACATCATTACTAATGAATAAAATGTTAAA
AGCATCATTAAGGAATTGCTCAATTATCTTCTTGCTGTTACTGATGAAGGTTTCCTCCGT
GAGCTTACAAACAAAATATGTGCAATTGTTGACAAACACTCACCTAACCGCAGATGGTAG
GTTGACACTATAATTAAAGTTTTGACACTTGCTGGTAATTATATTAAGGAAGAATCTACA
AATAATATGATCCACTTAATTTGTATGTCTCCTGAATTATAAAGCTATTCAGTCCATAAA
CTTTATTTCTCTCTAAATGAAAACATAAATTAAAATGGTTTAGCTAAAGCTGCTGTATAC
TGTATTGGTGAATTCGGACACTTACTCGTTAGAGGAACTCCAGTTGCACATCAAGATACT
AAGGTAACAGTTAAAGAAGAAGAAGTTATGCAACTTTTTGAAAAATTATTCGAACGCAAC
AAATTACCTGATAACATTAAGGAATATGGTTTAAATGCTTTGATTAAACTTTACCCTAAG
TTCTAAAACTCTTAAAATCGTATTATAGATTTAATTGAAATGTTTTAAACTTCTACTTCT
TTGGAAGTTCAAAAGCGTTCATGCGAATATCTCAAACTTATTGAATGCTAATGGGATGCT
AATAGAAACAGCATTCTTGAGCCTATTCCTCCTTATCAACCAGCAATCGATCAATATTCT
GTTAAACCAGTTGGTGATATTGACCTTGATGAATATCCTCCTGCTCCTTAAAATGCAAAT
ACTAGCGATTAAAGTAACGCTTTGAGCTAAATTGGTATTAATGATTTTGGAAATAACTCT
AAGTCTAATAATGCTGGAAACACTGCTGGAGGCGTTGATTTGTTAAATCTTCTTGTTGAT
GATGATGATGTATCCCCTGTTCCTACATACAATACTAATGTAGTTAATAGCTAAGTTGTT
TAAAACCCTCCTGCTTAACAAAATGATGGATTAAATTTACTTAATTTCTATGGTAACAGC
TAAGTTGGTGGAGTTACTCCATCAGTCAATACATTCAATCAAACTTAGAATGCATAATAA
AGTGGATACACTCCATAGAATATGGGAAATTTACTAGACTTTGGAGTTTCTTCTCCTTCA
ACTTTTGGAAATGCAACTCAAAGTTTAAGCTAGCCTGCCCATTCATTTACTGCATTTTCT
GATTCTAACTTAGATCTTGTCTTCAATTGTGATAGACTTGATACCACAACTACAATTACA
AGCATCTTCAATAATAAATCTGGGTTCCCTCTCACAGAAATAATTTTTTAGGTTGCCGTC
CTAAAGCACTTGAAGCTTACAATGCAACCCATTTCAAATACAATGATTGCTCCTTATTCA
TAAGGACAAACTACTTAAGTAATGACTGTATAAAATAGTATGTAAGGATAAAAAGGTATT
GCTCTTAAAATTAAAATAGGATATACTCTTAATGGTCAATAAGTAATACTTTCTTTATAT
TTTTAATATTAAAAAAATATTATATTTATTCAAACAGATTTCCTAACAAGTTCAAATTTC
TAACTTCCCTCAAGGATGGTGATTTTGAAATCGCTTATGTGTAAATAAACAATAAAAAAT
ATCCTTAAATACAATATAAATATAAAATAGAATAATGTATTTCTTTTAATTACTTACCTA
TCTATCTAGTTAATACTTAATTAAATTGGATTTTATTATCAATTTATGTTTTTCACATTT
TTTATTTTACTTTTTTTTTATTTATATTTACTTTTTAATTATTTTTTCTAAATAATTCAA
TAATCATCTTATTTTTTATTTTAAAAATTTATTGCTTTCATTTGTTTTTTATTCTCAAAA
AAATTAAAATTTTATTAAGTGAAAAGTTGA


>TTHERM_00715750(protein)
MSKEVPQKLRDLIKAIRGCKTTAEERALVQKEKALIRESFNKNEEEYRPRNVAKLLFINM
LGHNTDFGQMECLKLISAQSFTEKRIGYLGLTQLFHEQSDVLLMATSRLLTDLQSQNNYV
ASLAIIAVSEICTTDMCRELIGNILKIMQSGTSFTRKKAPLAAAKIMKKLPDHLPDIIEK
INTLMEDRHHGVLIATLGLIEEIILHDPTTKDKFKKYVTPMIKVLQGLVSHYDKDFEIAG
VVDPFLQMKILKFFRYMGKGDTTVSEEVSNVLASVSSNTNSSKNTGNAVLYECVQTIMEI
ESSSHLKTLGINILGKFLSQKDYNSKYCALFMLKQVVNHDINAVQKHKQTILDCMKESDI
SVKQLALDLVYIITNEQNVKSIIKELLNYLLAVTDEGFLRELTNKICAIVDKHSPNRRWQ
VDTIIKVLTLAGNYIKEESTNNMIHLICMSPELQSYSVHKLYFSLNENINQNGLAKAAVY
CIGEFGHLLVRGTPVAHQDTKVTVKEEEVMQLFEKLFERNKLPDNIKEYGLNALIKLYPK
FQNSQNRIIDLIEMFQTSTSLEVQKRSCEYLKLIECQWDANRNSILEPIPPYQPAIDQYS
VKPVGDIDLDEYPPAPQNANTSDQSNALSQIGINDFGNNSKSNNAGNTAGGVDLLNLLVD
DDDVSPVPTYNTNVVNSQVVQNPPAQQNDGLNLLNFYGNSQVGGVTPSVNTFNQTQNAQQ
SGYTPQNMGNLLDFGVSSPSTFGNATQSLSQPAHSFTAFSDSNLDLVFNCDRLDTTTTIT
SIFNNKSGFPLTEIIFQVAVLKHLKLTMQPISNTMIAPYSQGQTTQVMTVQNSMQGQKGI
ALKIKIGYTLNGQQVILSLYFQYQKNIIFIQTDFLTSSNFQLPSRMVILKSLMCKQTIKN
ILKYNINIKQNNVFLLITYLSIQLILNQIGFYYQFMFFTFFILLFFYLYLLFNYFFQIIQ
QSSYFLFQKFIAFICFLFSKKLKFYQVKS


>TTHERM_00715750(gene)
ATGAGTAAAGAAGTTCCTTAAAAGCTTAGAGATTTAATCAAGGCTATTAGAGGCTGCAAA
ACTACAGCCGAAGAAAGAGCTTTAGTATAAAAGGAGAAGGCATTGATTCGTGAATCATTT
AATGTAAAGGCTTTTCTCATATTTTAGTTTAAAATTTTAGCATTTGTCCATAATTTTTAA
ATTAAAGTAATCTAGCTATAAACAGGCCAAATAAATGATAATTTGATATAAAAATGCTTA
TTTTAATTTTCAAAGCTCAAAAATAATTTTTATTCAACTGAAATAGTTCGCATTTCAGAT
AAAATTTTTGCATGGAAACTAAGACAAAGAAAAAATATTTTAATTTGTTTTATAAAATAC
AGAAAAATGAAGAGGAATATAGACCAAGAAATGTAGCAAAATTGCTTTTTATCAATATGT
TAGGTCACAACACTGATTTCGGTCAAATGGAATGTTTGAAACTCATTTCTGCTTAGTCTT
TCACAGAAAAGAGAATAGGTTATTTAGGACTTACTTAACTTTTCCATGAATAGTCTGATG
TATTATTGATGGCAACTTCACGTCTCCTTACAGATTTATAAAGTTAAGTAAGTATTTAAG
ATATTTTAAACAAAAACAGACTACTTGAAGAATTAGAATTAGCATAAAATGAAGTTTTTT
AATATATTATTTTTTAAATTAGAATAATTATGTAGCAAGTTTAGCAATTATTGCAGTTAG
CGAAATATGTACAACTGATATGTGTAGAGAACTTATAGGTAATATACTTAAAATCATGCA
AAGTGGTACTTCTTTCACAAGAAAAAAAGCTCCACTTGCTGCTGCTAAAATTATGAAAAA
GTTGCCTGATCATTTACCTGATATTATTGAAAAAATTAACACCCTTATGGAAGATCGTCA
CCATGGTAAAATAAAAATTTTAAAGAAAATTAAATTTCAAATATAGAGAAGATATTTTTA
TTTGATGGAATTAATTTCTTCGTTGCTTTTATTTATTTGAACAATTCAATTTGTTGATGA
ATGTAATTAATCTAAAAACGAAGATAAGAAGACGTGTTATATTTAAATAAAAATATGACC
ACTTGAACAATACAAAATATATTCTTTACCAACTATATTTAATTATATATTTACAAATAA
TATATTATTTTTACAGGTGTTTTGATAGCAACTCTTGGTTTGATTGAAGAAATTATTTTA
CATGATCCTACAACCAAGGATAAATTCAAAAAATACGTCACTCCCATGATTAAAGTTCTT
TAAGGTTTGGTGTCTCATTACGATAAAGATTTTGAAATTGCTGGTGTGGTTGATCCTTTC
TTATAAATGAAGATCTTGAAATTCTTCAGATACATGGGTAAAGGAGATACTACAGTTTCT
GAAGAAGTTTCTAATGTCCTCGCATCAGTAACGATTTTGATTGAATTCATTAAATTCTTC
TTAAAAAAATATATAGTGATTAATTACTAAATATTATTTTTTATACATAGGTTTCTAGTA
ATACCAACAGTTCTAAAAACACAGGTAATGCTGTTCTCTATGAATGTGTGCAAACAATTA
TGGAAATTGAAAGTTCTAGTCATTTAAAAACATTAGGTATTAACATTTTAGGTAAATTCT
TAAGCTAAAAGGATTACAATAGCAAGTATTGTGCTTTATTCATGTTAAAGCAAGTTGTTA
ATCATGATATTAATGCTGTCTAAAAGCACAAATAAACTATTCTAGATTGTATGAAAGAAA
GTGATATTTCTGTCAAGCAGTTAGCTTTAGATTTAGTTTACATCATTACTAATGAATAAA
ATGTTAAAAGCATCATTAAGGAATTGCTCAATTATCTTCTTGCTGTTACTGATGAAGGTT
TCCTCCGTGAGCTTACAAACAAAGTGATTTGAATAATTTCTTAACCACAAAGTTTTATTT
TTTTACAAATATTTAACAGATATGTGCAATTGTTGACAAACACTCACCTAACCGCAGATG
GTAGGTTGACACTGTAAATTTCTATTTTATTTTTTTATCATAAATTTAAATTTTCACTTA
AACTAGATAATTAAAGTTTTGACACTTGCTGGTAATTATATTAAGGAAGAATCTACAAAT
AATATGATCCACTTAATTTGTATGTCTCCTGAATTATAAAGCTATTCAGTCCATAAACTT
TATTTCTCTCTAAATGAAAACATAAATTAAAATGGTTTAGCTAAAGCTGCTGTATACTGT
ATTGGTGAATTCGGACACTTACTCGTTAGAGGAACTCCAGTTGCACATCAAGATACTAAG
GTAAATATTTCATTAAAAAGCTTAATAAATATTTTATCTTCGATAATAATAAATTAATAT
AGGTAACAGTTAAAGAAGAAGAAGTTATGCAACTTTTTGAAAAATTATTCGAACGCAACA
AATTACCTGATAACATTAAGGAATATGGTTTAAATGCTTTGATTAAACTTTACCCTAAGT
TCTAAAACTCTTAAAATCGTATTATAGATTTAATTGAAATGTTTTAAACTTCTACTTCTT
TGGAAGTTCAAAAGCGTTCATGCGAATATCTCAAACTTATTGAATGCTAATGGGATGCTA
ATAGAAACAGCATTCTTGAGCCTATTCCTCCTTATCAACCAGCAATCGATCAATATTCTG
TGTAATATATTTTTCATATCAAACTAATTTTTCTAATTTATAATTTTAAATACAGTAAAC
CAGTTGGTGATATTGACCTTGATGAATATCCTCCTGCTCCTTAAAATGCAAATACTAGCG
ATTAAAGTAACGCTTTGAGCTAAATTGGTATTAATGATTTTGGAAATAACTCTAAGTCTA
ATAATGCTGGAAACACTGCTGGAGGCGTTGATTTGTTAAATCTTCTTGTTGATGATGATG
ATGTATCCCCTGTTCCTACATACAATACTAATGTAGTTAATAGCTAAGTTGTTTAAAACC
CTCCTGCTTAACAAAATGATGGATTAAATTTACTTAATTTCTATGGTAACAGCTAAGTTG
GTGGAGTTACTCCATCAGTCAATACATTCAATCAAACTTAGAATGCATAATAAAGTGGAT
ACACTCCATAGAATATGGGAAATTTACTAGACTTTGGAGTTTCTTCTCCTTCAACTTTTG
GAAATGCAACTCAAAGTTTAAGCTAGCCTGCCCATTCATTTACTGCATTTTCTGATTCTA
ACTTAGATCTTGTCTTCAATTGTGATAGAGTAATTCAACTCAATCAAATAATATTTTCTT
TAAATTTATTTTAATTAAAATTAGCTTGATACCACAACTACAATTACAAGCATCTTCAAT
AATAAATCTGGGTTCCCTCTCACAGAAATAATTTTTTAGGTTGCCGTCCTAAAGCACTTG
AAGCTTACAATGCAACCCATTTCAAATACAATGATTGCTCCTTATTCATAAGGACAAACT
ACTTAAGTAATTAATTTAAAAATCTTAACAAGTTTATTAATTTTTGATAATGAAAAAGGT
AATGACTGTATAAAATAGTATGTAAGGATAAAAAGGTATTGCTCTTAAAATTAAAATAGG
ATATACTCTTAATGGTCAATAAGTAATACTTTCTTTATATTTTTAATATTAAAAAAATAT
TATATTTATTCAAACAGATTTCCTAACAAGTTCAAATTTCTAACTTCCCTCAAGGATGGT
GATTTTGAAATCGCTTATGTGTAAATAAACAATAAAAAATATCCTTAAATACAATATAAA
TATAAAATAGAATAATGTATTTCTTTTAATTACTTACCTATCTATCTAGTTAATACTTAA
TTAAATTGGATTTTATTATCAATTTATGTTTTTCACATTTTTTATTTTACTTTTTTTTTA
TTTATATTTACTTTTTAATTATTTTTTCTAAATAATTCAATAATCATCTTATTTTTTATT
TTAAAAATTTATTGCTTTCATTTGTTTTTTATTCTCAAAAAAATTAAAATTTTATTAAGT
GAAAAGTTGA