Identifiers and Description

Gene Model Identifier

TTHERM_00316010

Standard Name

APE4 (Adaptor Protein 4 complex Epsilon subunit 4)

Aliases

PreTt20912 | 31.m00214 | 3687.m00016

Description

Adaptin complex 4 (AP-4), epsilon subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00316010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08491.19.997093137033517e-262adaptin N-terminal region fami
ly protein (919 aa)
OxytrichaContig20452.0.1.g179.997093137033517e-262Adaptin N terminal region
DictyBaseDDB_G02804272.9986068920536807e-84ap4e1 on chromosome: 3 positio
n 3335352 to 3338884
Stentor CoeruleusSteCoe_257748.074506789675094e-73
WormBaseWBGene000001584.001202823045957e-54locus:apg-1 status:Partially
_confirmed UniProt:Q8WQB3
protein_id:CAD21660.1
SGDYPL195W2.000620012690291e-23APL5 Delta adaptin-like subuni
t of the clathrin associated p
rotein complex (AP-3); functio
ns in transport of alkaline ph
osphatase to the vacuole via t
he alternate pathway, suppress
or of loss of casein kinase 1
function

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00316010(coding)
ATGAGTTAATCATAACAGCTAACCAAAGAAATGCATGACTTAATCAAGTCTATAGGTGAG
ACTCGTTCTAAGCAAGAAGAAGATAAAATCATCCTTGCTGAATAAGCCAAATTGAAGGTT
TCAATTAAAGATTAATCGCTTTCAACTCGTAGATAGAAGGAAAATTTGATCAAAGCAATT
TATATTGAAATGTTAGGACACGATGCTAGTTTCGCACATTTCAGCGCAGTTTAAATGGCT
CAATCAAAAAGTCTTTAAATGAAGAGACTTGGTTATTTAACTTGCTGTCTCTTTTTGAAT
GAATAAAGTGATCTTCTCATTCTTCTTGTTGCAAATTTGTAAAAAGATCTGTAATCTAAA
AACATCCACGAAGTCGTAATAGCCTTAACTGCATTAGGAAAGTTAATGAACAAGACTATT
TTACAAGGTGTCTTAGATTTGATCATAAAATTGTTAATACATCACACTGATTTGGTAAGA
AAGAAAGCTATCATGGTATTACAAAGAATTCACAACATTTCTCCTGATTCAATTCCTGAT
TACGATGATAAAATGCGCCGTGCTCTTTGCGATTTCGAACCTTCAGTTATGGGAGTTGCC
CTTAATCTTTACCTTGAAGCTGTTAAGGAAGATCCCACTAAATACAAAGAATCAGCAGGC
TCTTTTGTTTTAATTTTGAAATAAGTTATTGAACACAAATTACCTCGTGAGTTCGACTAT
GCTCGTATTCCTGCTCCTTGGATCTAAATCAAAATTTTATAGATCCTATCTATATTAGGT
AAAAAGGACTAAAAGGTATCAGAATAAATTTATGAAATTTTGGGATAGGCTCTTCGTAGA
AGCGATGATTCAGGAAGCAAGATAGGATTTGCAGTTACTTACTAATGCGTTAAGACTATT
GCTACTATCTATCCCTATTAAAGTCTCCTCGAATAAGCTGCTTCTGCTGTTTAAAGATTT
TTAACTGCTGAAAATAACAATTTGAAGTACTTGGGTATAAATGCTCTCATTTCAATCGTT
TAGGTAAATGCTGCTTATGTCCATGAGCATTAATTAATCATTATTGACTGCTTAGAAAGC
AATGATGAAACTTTGAAGAAAGAGACTATGGAACTCTTATATAAAATGACTAATGTTAAG
AATGTAGAAGCTATAGTTGGTAGACTAATTGTATTCTTGAAAACAAGCTCTGATCCTTTC
TTCAGAAGAAATTTAGTAAACAAAATTACTTCCTTGGCTGATAGACATTCTCCAAGCAAT
GAATGGTTCTTAAAAACTATGAATCTCGTATTTGAGTACGGTAGTGAGTACATCAGCAGC
GATATTTTGAACACCTTCTTAAAAACTTTGAATGAAAATTTCTCCGCAAGTGGAGTCTAA
TTTGGTACTTACTTGATTGATACTTACTTAGAAACAATTAAGAAACCCAATCTCTCTGAC
GTAACCTTTTAAATGATCGCTTGGGTTTTTGGTGAAATTGGTGCTGCAACTTATGGTAAC
GATGAAACTTAACTTTAAAAGTTGATTGAATGCTTGCTTGAATCTATCACAAATGATTTT
GAAAATACTTCAACTAGAGGATGGTTCTTGAATGCTTTAGCTAAATTATCTTCTTGCTCT
GCTTTCAATATGCAAGAATAAGTAGCTGCATGTCTCGACTATTATGGGGAATCTCGCTGT
TTAGAAGTATCTTCTAGATCTACAGAATATAAGATTCTTTCAAAGTACAATGCTGCTTTG
AGATAATCTTCTGCTATTAAAGTTGATACCAAGTTAAACTTCCTTAACGATTTTATTGAA
AGATCTGTTAGAAACGGAGCACCTCGTTTTAATTCTAACAAAATTATACAAGCTGTTATG
AGCAACGATAAAGCATTAAACTTTGCACCTGTTGATTCAAGACACACTGCAAAATCAGAT
TAAGAAGAAGTCTTAAAATTAACCAATAATAAGGCTAATCCTTGGGGTTAAGAAGGATTT
GTTTAACCTGAATAACCTGCCAAGGCTCCTATCTAAAAAGAGGCTGAGAAAGGACAAAAG
TCTTTTTCTAATAAAGATTACCCAAGCGGACCATACATACCTGGCACAGATATATGGAAA
AATAAAGAGCAAGATAAACCAAATAGCAATCCTACTCCTCCTCCTCCTAAAAAAGTTGAA
CCTGAAGATACCAAAAAGAAGCAATAAACTAAAATGGCAGAGATGTTTTTCGGTGGAATT
ACAACTACTGGTCCCGCAGCAACCAACACAACTACCACAACAAAGCCTATTGTGTATTAA
AACACTAATCCTTATGGCTAAACTCCTTCAGTCAATAATTAGGCAATTAATTTACTTGAA
GATGATGATTTACCTTCTTTCACTTCTCAAAAACCAGCTGGTCCATCTTTCACTCCCATA
AACATCAATGTTGAATAATATGAAAATTATTGGGAATAATTTAGATTTGAAGAAAACTAA
GATATTAAGAGCAATAAAGTTAAAACAGAATACGAATTCAGAAATATGCTAACTAATATT
GGAATTGGTGTTGTTGAAGTTGATAACAATGAATTAATTTGTGCAGGTAAAAACATCAGT
TCATAAAATATCATGCTTTTGTATGGATCCTACACTGCATTAGGAAATCTTTCAATCACA
ATGAAGTCTAATTCTAAGCAAGAAATTGATTAAATATTTAATACTATCAAAACCAGATTT
GTTTGA


>TTHERM_00316010(protein)
MSQSQQLTKEMHDLIKSIGETRSKQEEDKIILAEQAKLKVSIKDQSLSTRRQKENLIKAI
YIEMLGHDASFAHFSAVQMAQSKSLQMKRLGYLTCCLFLNEQSDLLILLVANLQKDLQSK
NIHEVVIALTALGKLMNKTILQGVLDLIIKLLIHHTDLVRKKAIMVLQRIHNISPDSIPD
YDDKMRRALCDFEPSVMGVALNLYLEAVKEDPTKYKESAGSFVLILKQVIEHKLPREFDY
ARIPAPWIQIKILQILSILGKKDQKVSEQIYEILGQALRRSDDSGSKIGFAVTYQCVKTI
ATIYPYQSLLEQAASAVQRFLTAENNNLKYLGINALISIVQVNAAYVHEHQLIIIDCLES
NDETLKKETMELLYKMTNVKNVEAIVGRLIVFLKTSSDPFFRRNLVNKITSLADRHSPSN
EWFLKTMNLVFEYGSEYISSDILNTFLKTLNENFSASGVQFGTYLIDTYLETIKKPNLSD
VTFQMIAWVFGEIGAATYGNDETQLQKLIECLLESITNDFENTSTRGWFLNALAKLSSCS
AFNMQEQVAACLDYYGESRCLEVSSRSTEYKILSKYNAALRQSSAIKVDTKLNFLNDFIE
RSVRNGAPRFNSNKIIQAVMSNDKALNFAPVDSRHTAKSDQEEVLKLTNNKANPWGQEGF
VQPEQPAKAPIQKEAEKGQKSFSNKDYPSGPYIPGTDIWKNKEQDKPNSNPTPPPPKKVE
PEDTKKKQQTKMAEMFFGGITTTGPAATNTTTTTKPIVYQNTNPYGQTPSVNNQAINLLE
DDDLPSFTSQKPAGPSFTPININVEQYENYWEQFRFEENQDIKSNKVKTEYEFRNMLTNI
GIGVVEVDNNELICAGKNISSQNIMLLYGSYTALGNLSITMKSNSKQEIDQIFNTIKTRF
V


>TTHERM_00316010(gene)
ATGAGTTAATCATAACAGCTAACCAAAGAAATGCATGACTTAATCAAGTCTATAGGTGAG
ACTCGTTCTAAGCAAGAAGAAGATAAAATCATCCTTGCTGAATAAGCCAAATTGAAGGTT
TCAATTAAAGATTAATCGCTTTCAACTCGTAGATAGAAGGAAAATTTGATCAAAGCAATT
TATATTGAAATGTTAGGACACGATGCTAGTTTCGCACATTTCAGCGCAGTTTAAATGGCT
CAATCAAAAAGTCTTTAAATGAAGAGACTTGGTTATTTAACTTGCTGTCTCTTTTTGAAT
GAATAAAGTGATCTTCTCATTCTTCTTGTTGCAAATTTGTAAAAAGATCTGTAATCTAAA
AACATCCACGAAGTCGTAATAGCCTTAACTGCATTAGGAAAGTTAATGAACAAGACTATT
TTACAAGGTGTCTTAGATTTGGTAATTCATTTTTCAAGATTACTTTTAATTTTTCAAAAG
ATATTTTAAAAAATAATTTAACAAATAAATGAGCAATAAATTATTCAATTTGAAAAAGTA
AAATGAAGCTCAACAAATAATAACTGAAATCGAATTATAGATTCTGCATCTTCATTTTAA
ATAATGAAAAATTAAATATTTATTCAAATGTTTGAATATAGTTAAAATGGCTTTAAATTT
ATCAGCTTTTTTATGAAAATCAGAAGAATTTTTTAACAATTTAATTTTTTTTTTGATGCA
TTGATTTTGATGAATATATAAATGTAAGTTTAATTTTTACAAATCGCAAATTAAATTTTA
TATTTTCTCAATAATATATTTTATAAACGCATTCTTTACTTACTAAATGTCCATATTAGT
GATAAAAGCAATAACAAAATTAGTATAAAAAGCTAGCTTTACTAATATCTTTGTTATTTT
AATATGATTAATACTTATTTAGCTTAAATAAATTATCAACTTAAATTCAATAAATAAATT
AAATTTAGATCATAAAATTGTTAATACATCACACTGATTTGGTAAGAAAGAAAGCTATCA
TGGTATTACAAAGAATTCACAACATTTCTCCTGATTCAATTCCTGATTACGATGATAAAA
TGCGCCGTGCTCTTTGCGATTTCGAACCTTCAGTTATGGGAGTTGCCCTTAATCTTTACC
TTGAAGCTGTTAAGGAAGATCCCACTAAATACAAAGAATCAGCAGGCTCTTTTGTTTTAA
TTTTGAAATAAGTTATTGAACACAAATTACCTCGTGAGTTCGACTATGCTCGTATTCCTG
CTCCTTGGATCTAAATCAAAATTTTATAGATCCTATCTATATTAGGTAAAAAGGACTAAA
AGGTATCAGAATAAATTTATGAAATTTTGGGATAGGCTCTTCGTAGAAGCGATGATTCAG
GAAGCAAGATAGGATTTGCAGTTACTTACTAATGCGTTAAGACTATTGCTACTATCTATC
CCTATTAAAGTCTCCTCGAATAAGCTGCTTCTGCTGTTTAAAGATTTTTAACTGCTGAAA
ATAACAATTTGAAGTACTTGGGTATAAATGCTCTCATTTCAATCGTTTAGGTATTTAAAT
AAATATTTTATTTCAAAAAAAAATAGCAGATACCTTTGATATTGATTTCTTTTTAATTGT
CTTCGCATAAATAAATATAAACTAAAATTTATGAATATTATTTTGTAAATAAAAAGGTAA
ATGCTGCTTATGTCCATGAGCATTAATTAATCATTATTGACTGCTTAGAAAGCAATGATG
AAACTTTGAAGAAAGAGACTATGGAACTCTTATATAAAATGACTAATGTTAAGAATGTAG
AAGCTATAGTTGGTAGACTAATTGTATTCTTGAAAACAAGCTCTGATCCTTTCTTCAGAA
GAAATTTAGTAAACAAAATTACTTCCTTGGCTGATAGACATTCTCCAAGCAATGAATGGT
TCTTAAAAACTATGAATCTCGTATTTGAGTACGGTAGTGAGTACATCAGCAGCGATATTT
TGAACACCTTCTTAAAAACTTTGAATGAAAATTTCTCCGCAAGTGGAGTCTAATTTGGTA
CTTACTTGATTGATACTTACTTAGAAACAATTAAGAAACCCAATCTCTCTGACGTAACCT
TTTAAATGATCGCTTGGGTTTTTGGTGAAATTGGTGCTGCAACTTGTAATTTATTTCATA
AATATTTTTAATTAAAATTTGAAATATAATTTAACTTTTTAATAGATGGTAACGATGAAA
CTTAACTTTAAAAGTTGATTGAATGCTTGCTTGAATCTATCACAAATGATTTTGAAAATA
CTTCAACTAGAGGATGGTTCTTGAATGCTTTAGCTAAATTATCTTCTTGCTCTGCTTTCA
ATATGCAAGAATAAGTAGCTGCATGTCTCGACTATTATGGGGAATCTCGCTGTTTAGAAG
TATCTTCTAGATCTACAGAATATAAGATTCTTTCAAAGTACAATGCTGCTTTGAGATAAT
CTTCTGCTATTAAAGTTGATACCAAGTTAAACTTCCTTAACGATTTTATTGAAAGATCTG
TTAGAAACGGAGCACCTCGTTTTAATTCTAACAAAATTATACAAGCTGTTATGAGCAACG
ATAGTAAATTTATTGATTTTAATTCTACATTTTTTATTAAATTTTTTTGATAAAAAACTA
TTCAGAAGCATTAAACTTTGCACCTGTTGATTCAAGACACACTGCAAAATCAGATTAAGA
AGAAGTCTTAAAATTAACCAATAATAAGGCTAATCCTTGGGGTTAAGAAGGATTTGTTTA
ACCTGAATAACCTGCCAAGGCTCCTATCTAAAAAGAGGCTGAGAAAGGACAAAAGTCTTT
TTCTAATAAAGATTACCCAAGCGGACCATACATACCTGGCACAGATATATGGAAAAATAA
AGAGCAAGATAAACCAAATAGCAATCCTACTCCTCCTCCTCCTAAAAAAGTTGAACCTGA
AGATACCAAAAAGAAGCAATAAACTAAAATGGCAGAGATGTTTTTCGGTGGAATTACAAC
TACTGGTCCCGCAGCAACCAACACAACTACCACAACAAAGCCTATTGTGTATTAAAACAC
TAATCCTTATGGCTAAACTCCTTCAGTCAATAATTAGGCAATTAATTTACTTGAAGATGA
TGATTTACCTTCTTTCACTTCTCAAAAACCAGCTGGTCCATCTTTCACTCCCATAAACAT
CAATGTTGAATAATATGAAAATTATTGGGAATAATTTAGATTTGAAGAAAACTAAGATAT
TAAGAGCAATAAAGTTAAAACAGAATACGAATTCAGAAATATGCTAACTAATATTGGAAT
TGGTGTTGTTGAAGTTGATAACAATGAATTAATTTGTGCAGGTAAAAACATCAGTTCATA
AAATATCATGCTTTTGTATGGATCCTACACTGCATTAGGAAATCTTTCAATCACAATGAA
GTCTAATTCTAAGCAAGAAATTGATTAAATATTTAATACTATCAAAACCAGATTTGTTTG
A