Identifiers and Description

Gene Model Identifier

TTHERM_00825120

Standard Name

APC2 (Anaphase-Promoting Complex subunit 2)

Aliases

PreTt03976 | 142.m00073 | 3683.m00006

Description

Anaphase-promoting complex subunit; promotes anaphase stage of mitosis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • ubiquitin-dependent protein catabolic process (IEA) | GO:0006511

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00825120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18317.19.997093137033517e-262hypothetical protein (843 aa)
OxytrichaContig9717.0.g946.001629673589058e-65Cullin family
DictyBaseDDB_G02763779.997652352281279e-57anapc2 on chromosome: 2 positi
on 6676259 to 6679209
WormBaseWBGene000001432.998800627344286e-26locus:apc-2 Anaphase-promoti
ng complex subunit 2 status:
Confirmed UniProt:P34514 p
rotein_id:CCD64457.1
Stentor CoeruleusSteCoe_330716.47023492564546e-26
SGDYLR127C0.0000000000008001317446409227APC2 Subunit of the Anaphase-P
romoting Complex/Cyclosome (AP
C/C), which is a ubiquitin-pro
tein ligase required for degra
dation of anaphase inhibitors,
including mitotic cyclins, du
ring the metaphase/anaphase tr
ansition; component of the cat
alytic core of the APC/C; has
similarity to cullin Cdc53p

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00825120(coding)
ATGAATATATTTGAAATATTTTAGCACGATGAATACATTAAATAGAATCCAGAGATTCTA
TAATTTATTTACGAGATGTAAAAGGAATGGATAGATTTTAAGGGAATTATAGACAAATTG
TTTGTAGATTTAGAATACAATAAGCTTAAAGTTAGAGAGTAATGGAATGTTATAACCTAA
AAGAGATAGCCTTTAGTTAGAATAATTAGAGAGTACTATTTTAATAAATTTGAAAAGCAT
ATGCTTAAAGAATACAAAGATGAATTCTATTCTATACTGAACTTAGATAGAACGGAAAGC
GAGATAAATACTCAAAATTTTATTAAGGCACTACTTTCTCTTAATAAAAAATATGAAATT
CATATGAACTTCTTGCAAGATCTTGATTTAGAGTGTGAAGAAATGCAAAAAAAATAAAAT
TTATCAGTTAATTTATCTTAGATATTTAGCTTGAACCTTATTGAGATAGCAAATTTAAAT
GAAAATATATATGCTTTCTACAGAAAAGAGCTTATAAAATTTATGAAATTCGTATTAAAA
GAACACTCAAGCCAAATAGATCAATCGCTTATTACTGAATCTAGAAGAACTCTTATAGAA
AATGAACCTGAAAACTTTTAAGTTGATATCTACTAAAACTTTTTTTAAATATCTATTGAA
CTTGGATTCTACACAAAATCCTTATAAATATTGAATGAAGTGCTTGTAAAAGACATTCAA
GAGTATATAGAGAGCTAATAAGAGGCTCTATAAAATAATACTCCTATTTTAAAGAGGTGT
ATTTCATATTTTTCTAACTTTCACTTAAATTTTCTTCAAGTTATTGCTCAGAGTGTTAAA
ACAATATCGAGTAAAGAAATATAACTTGAATAACTATAAGGAGAGCTTAAAATTCTTTAA
GATTAGCTTTTGAGTAAAATATATGAGATCTATGGTAAAATATGTATATAAAATATTTTC
AGAATCGTGTTAGAGTTTCCAGAATCTTACGAACTTGTCTAAGAATTAAAAGAAATTGTT
GAAAAGACAAATCTAATATTTGACATGTGTGATTTTTTGTCTAGTTAAATTAGTTAAAGA
TTGCTAATACCTGGAGTTATAACAACAAACATTTTAAGCTAATACATAAATTGTCTTTAA
ATTCTTTAAATTATAGATCCAAAAGCTCTTATTTTGGAAAAAGTTACTTTTCCTATTAAA
AATTATCTGCTTAAAAGAAATGATACATTGAGATGCATTATTGAGCATTTAACTGATGAT
AAAAATACAAATAAATTAGTTCAAGAAAGACTAAAAATTCCTTCTAAATTTTAAAGTTAT
GATTTATCCTCAGATGAAGATGAAAACGAGGCAGAGAAATGGGAAGTTTAATATTTAAAC
TAAAAAAAATCGGAAGCAATTAAAATTAAGTATTAGGAGAGTGACTTACTTAGTATTTTG
GTTAACTTGTATGGATCACAAGAATCTTTCATTAGCGAGTATCAAAATATGCTTGCAGAA
AAAATGATGGGAACAAGAAATTTTGATATTGATGAAGAAATCAAAAATTTAGAACTTTTG
AAATTAAGATGTGGAGACTACAGCCTACAAACTTGCAACATTATAGTTAAGGATGTTAAG
GATTCAAAAAGAATTGACAACTTGATTCATTCATATAAAAAACCTATTAACCCTGAAGCA
TCTCTTAAGAATCCTCTACTTTCTATTGATTAACTTCACTGCATGTTTGTTTCTAAAGGA
TATTGGCCTATTAATTATGAAGTGGAAGGATTTCCTCTTCCTTCTTATTTAGAGCCACTC
TTCTAAGAATATGCAAAGAGATTTGAAAGAAATAGAGCTATGCGTAAGCTAATCTGGCAC
ACAAATCTTGGTCACGTTAATCTCACTCTTACATTTGATAATGGAGAATTTGAATTTAAG
TGTCTCCCAATTCATGCAATCTTAATTGGTTATTTTGATGAAACAAGATTTAATCCAGAA
AAAGGAGTTTCATCTGATTTTTTGAGTCAAGAAACATAGTTATCATAAAACTAAGTAAAG
TAGAAAATGGCTTTTTGGGTTCATAAAGGAGTTGTAAGAGAGTTTAAAAAGTAAGTGCCA
AAAGCTTAATCAAGTAATTTCAAGAATTTCTAAGGATACAATGAAGAAGGTGCAGAGAAC
GCTGATAATGATGTTAATGTATACTTTCCTGTTAGGGTTTATGAGAAATTTAGGGATTCA
GAAAATCTTATTTACTGTGAAGATGAAGAAAATGAAATGATTCTTAGAGATTAGTCTTAC
ATAGGATTTGAAAATACTCAATTTATAAAATATATCGAAAACTTGATAATTAGCATCTTA
AATAAAACCGGTCCAAGATCAGCTTCATAACTACATTGCTTGCTAAAGACACTCTATAAA
ACTGATTTAGAATATCCTGTTTAAGAAGATTAGATTAAAGATGTGCTTAGAAATATGAGC
CAAAAACATAAATTGATATTCAATGGTGAAGACTACTCATTACCTATTAGTTAAGAAAAA
GTTTAATGA


>TTHERM_00825120(protein)
MNIFEIFQHDEYIKQNPEILQFIYEMQKEWIDFKGIIDKLFVDLEYNKLKVREQWNVITQ
KRQPLVRIIREYYFNKFEKHMLKEYKDEFYSILNLDRTESEINTQNFIKALLSLNKKYEI
HMNFLQDLDLECEEMQKKQNLSVNLSQIFSLNLIEIANLNENIYAFYRKELIKFMKFVLK
EHSSQIDQSLITESRRTLIENEPENFQVDIYQNFFQISIELGFYTKSLQILNEVLVKDIQ
EYIESQQEALQNNTPILKRCISYFSNFHLNFLQVIAQSVKTISSKEIQLEQLQGELKILQ
DQLLSKIYEIYGKICIQNIFRIVLEFPESYELVQELKEIVEKTNLIFDMCDFLSSQISQR
LLIPGVITTNILSQYINCLQILQIIDPKALILEKVTFPIKNYLLKRNDTLRCIIEHLTDD
KNTNKLVQERLKIPSKFQSYDLSSDEDENEAEKWEVQYLNQKKSEAIKIKYQESDLLSIL
VNLYGSQESFISEYQNMLAEKMMGTRNFDIDEEIKNLELLKLRCGDYSLQTCNIIVKDVK
DSKRIDNLIHSYKKPINPEASLKNPLLSIDQLHCMFVSKGYWPINYEVEGFPLPSYLEPL
FQEYAKRFERNRAMRKLIWHTNLGHVNLTLTFDNGEFEFKCLPIHAILIGYFDETRFNPE
KGVSSDFLSQETQLSQNQVKQKMAFWVHKGVVREFKKQVPKAQSSNFKNFQGYNEEGAEN
ADNDVNVYFPVRVYEKFRDSENLIYCEDEENEMILRDQSYIGFENTQFIKYIENLIISIL
NKTGPRSASQLHCLLKTLYKTDLEYPVQEDQIKDVLRNMSQKHKLIFNGEDYSLPISQEK
VQ


>TTHERM_00825120(gene)
ATGAATATATTTGAAATATTTTAGCACGATGAATACATTAAATAGAATCCAGAGATTCTA
TAATTTATTTACGAGATGTAAAAGGAATGGATAGATTTTAAGGGAATTATAGACAAATTG
TTTGTAGATTTAGAATACAATAGTAATTTATTTTTTACAACATTATCAAAAAGATTCATA
ATAGTTATCTGTGACTAAAGCAAAATAAAAATAATACTAAAATTTTGAGAAATTTAAACG
TATATTCATTTTTTAATATATTAGAGCTTAAAGTTAGAGAGTAATGGAATGTTATAACCT
AAAAGAGATAGCCTTTAGTTAGAATAATTAGAGAGTACTATTTTAGTAATTAGGATTTTA
TTTTAATGTAGCTTAAATAATAAAAATATTTTATTTATAGATAAATTTGAAAAGCATATG
CTTAAAGAATACAAAGATGAATTCTATTCTATACTGAACTTAGATAGAACGGAAAGCGAG
ATAAATACTCAAAATTTTATTAAGGCACTACTTTCTCTTAATAAAAAATATGAAATTCAT
ATGAACTTCTTGCAAGATCTTGATTTAGAGTGTGAAGAAATGCAAAAAAAATAAAATTTA
TCAGTTAATTTATCTTAGATATTTAGCTTGAACCTTATTGAGATAGCAAATTTAAATGAA
AATATATATGCTTTCTACAGGTATAGCTGAATTTTTATAATTTCTTTAATTTTCTTTTTC
TTTGAAAAGCAAAAAGTAGTTAAAAAATGTTAATTGATATAGCTTTTATTTATAATTAGA
AAAGAGCTTATAAAATTTATGAAATTCGTATTAAAAGAACACTCAAGCCAAATAGATCAA
TCGCTTATTACTGAATCTAGAAGAACTCTTATAGAAAATGAACCTGAAAACTTTTAAGTT
GATGTAAGTTTAAAAAAAAAATAAATTATCTAGAATTAAAATTTAAATTTACTTAATTAT
TAGATCTACTAAAACTTTTTTTAAATATCTATTGAACTTGGATTCTACACAAAATCCTTA
TAAATATTGAATGAAGTGCTTGTAAAAGACATTCAAGAGTATATAGAGAGCTAATAAGAG
GCTCTATAAAATAATACTCCTATTTTAAAGAGGTGTATTTCATATTTTTCTAACTTTCAC
TTAAATTTTCTTCAAGTTATTGCTCAGAGTGTTAAAACAATATCGAGTAAAGAAATATAA
CTTGAATAACTATAAGGAGAGCTTAAAATTCTTTAAGATTAGCTTTTGAGTAAAATATAT
GAGATCTATGGTAAAATATGTATATAAAATATTTTCAGAATCGTGTTAGAGTTTCCAGAA
TCTTACGAACTTGTCTAAGAATTAAAAGAAATTGTTGAAAAGACAAATCTAGTAAATAAA
TAATAAAAAAATTTATAATTTTATCAAACTTAAAAAACTAATTTTCTTAAAAATTAGATA
TTTGACATGTGTGATTTTTTGTCTAGTTAAATTAGTTAAAGATTGCTAATACCTGGAGTT
ATAACAACAAACATTTTAAGCTAATACATAAATTGTCTTTAAATTCTTTAAATTATAGAT
CCAAAAGCTCTTATTTTGGGTAATTTAACATATCTATTTGTCATAACTAAATAACTAACT
AAATAAACTTAAATTAATTTATAGAAAAAGTTACTTTTCCTATTAAAAATTATCTGCTTA
AAAGAAATGATACATTGAGATGCATTATTGAGCATTTAACTGATGATAAAAATACAAATA
AATTAGTTCAAGAAAGACTAAAAATTCCTTCTAAATTTTAAAGTTATGATTTATCCTCAG
ATGAAGATGAAAACGAGGCAGAGAAATGGGAAGTTTAATATTTAAACTAAAAAAAATCGG
AAGCAATTAGTATTAAATATTTTGTTTAAAGCTTGTTTTTAATTATTTATTGGTAAAGAA
ATTAAGTATTAGGAGAGTGACTTACTTAGTATTTTGGTTAACTTGTATGGATCACAAGAA
TCTTTCATTAGCGAGTATCAAAATATGCTTGCAGAAAAAATGATGGGAACAAGAAATTTT
GATATTGATGAAGAAATCAAAAATTTAGAACTTTTGAAATTAAGATGTGGAGACTACAGC
CTACAAGTAATTGATTGTTGTCAGCTAAAAATTTTTTAATGATAAAAATAAAATATAAAT
TAGACTTGCAACATTATAGTTAAGGATGTTAAGGATTCAAAAAGAATTGACAACTTGATT
CATTCATATAAAAAACCTATTAACCCTGAAGCATCTCTTAAGAATCCTCTACTTTCTATT
GATTAACTTCACTGCATGTTTGTTTCTAAAGGATATTGGCCTATTAATTATGAAGTGGAA
GGATTTCCTCTTCCTTCTTATTTAGAGCCACTCTTCTAAGAATATGCAAAGAGATTTGAA
AGAAATAGAGCTATGCGTAAGCTAATCTGGCACACAAATCTTGGTCACGTTAATCTCACT
CTTACATTTGATAATGGAGAATTTGAATTTAAGTGTCTCCCAATTCATGCAATCTTAATT
GGTTATTTTGATGAAACAAGTATAAAAAAGTTAAAGTTGTATTTAGAGTAAAAATATTTT
ATTATAAAATAAATAGGATTTAATCCAGAAAAAGGAGTTTCATCTGATTTTTTGAGTCAA
GAAACATAGTTATCATAAAACTAAGTAAAGTAGAAAATGGCTTTTTGGGTTCATAAAGGA
GTTGTAAGAGAGTTTAAAAAGTAAGTGCCAAAAGCTTAATCAAGTAATTTCAAGAATTTC
TAAGGATACAATGAAGAAGGTGCAGAGAACGCTGATAATGATGTTAATGTATACTTTCCT
GTTAGGGTTTATGAGAAATTTAGGGATTCAGAAAGTAAAGTGAGAAAATCTTATTCTTTA
ATAACAGTATTTTATATTTAAAATAGATCTTATTTACTGTGAAGATGAAGAAAATGAAAT
GATTCTTAGAGATTAGTCTTACATAGGATTTGAAAATACTCAATTTATAAAAGTATTTAT
TAAATTATTTATTCTATTCATTTAATTTTAACCCTATTTTATTCTTTTTATTTTTTAGTA
TATCGAAAACTTGATAATTAGCATCTTAAATAAAACCGGTCCAAGATCAGCTTCATAACT
ACATTGCTTGCTAAAGACACTCTATAAAACTGATTTAGAATATCCTGTTTAAGAAGATTA
GATTAAAGATGTGCTTAGAAATATGAGCCAAGTAATTCATTAAAAATTATTCAATTTTAA
ACTTTATAAATTTAAAATTTTTAACAATAAGAAACATAAATTGATATTCAATGGTGAAGA
CTACTCATTACCTATTAGTTAAGAAAAAGTTTAATGA