Identifiers and Description

Gene Model Identifier

TTHERM_00522770

Standard Name

APC11 (Anaphase Promoting Complex subunit 11)

Aliases

PreTt12392 | 65.m00210 | 3717.m00089

Description

Anaphase promoting complex subunit; promotes anaphase stage of mitosis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 19%

TetraMine Data

TTHERM_00522770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12831.11.9992362000979228e-56hypothetical protein (84 aa)
DictyBaseDDB_G02869098.001486403440551e-25anapc11 on chromosome: 4 posit
ion 5059870 to 5060410
WormBaseWBGene000001457.996041293534585e-17locus:apc-11 status:Confirme
d UniProt:Q20052 protein_i
d:CAA86328.1
SGDYDL008W1.000361553249356e-16APC11 Catalytic core subunit o
f the Anaphase-Promoting Compl
ex/Cyclosome (APC/C), which is
a ubiquitin-protein ligase re
quired for degradation of anap
hase inhibitors, including mit
otic cyclins, during the metap
hase/anaphase transition; cont
ains a RING-H2 domain that is
required for activity
OxytrichaContig254.1.g194.0002685161515803e-16RING-H2 zinc finger

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00522770(coding)
ATGAGAGTTAAAATATAAAGTTGGAATGCTTTAGCAACTTGGGTTTGGGACATTGAAAAT
GAAGAAATGTGTGCAATTTGTAGACAGCCATTTGAGTCTCCCTGCCCTAAATGCAAAATG
CCTGGAGATGACTGTGTTCCAATTGCAGGAGAATGCAATCATCATTTTCATATGCATTGT
ATTATTAGATGGATAGAAGAAGGTTCTGATAAATGTCCTCTTGATAGATCTAAATGGGTT
TTTAAAAACTGA


>TTHERM_00522770(protein)
MRVKIQSWNALATWVWDIENEEMCAICRQPFESPCPKCKMPGDDCVPIAGECNHHFHMHC
IIRWIEEGSDKCPLDRSKWVFKN


>TTHERM_00522770(gene)
ATGAGAGTTAAAATATAAAGTTGGAATGCTTTAGCAACTTGGGTTTGGGACATTGAAAAT
GAAGAAATGTGTGCAATTTGTAGACAGCCATTTGAGTCTCCCTGCCCTAAATGCAAAATG
CCTGGAGATGACTGTGTTCCAAGTAAATATCAAATTTAATAAAAAGCATGTTTTAATATT
AAATTTATTTAAAAATATTTAGTTGCAGGAGAATGCAATCATCATTTTCATATGCATTGT
ATTATTAGATGGATAGAAGAAGGTTCTGATAAATGTCCTCTTGATAGATCTAAATGGGTT
TTTAAAAACTGA