Identifiers and Description

Gene Model Identifier

TTHERM_00526690

Standard Name

APC10 (Anaphase-Promoting Complex 10)

Aliases

PreTt06407 | 66.m00206 | 3722.m00064

Description

Anaphase-promoting complex subunit; mediates the transition from metaphase to anaphase by destroying anaphase inhibitor proteins; expressed during early conjugation and meiosis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • regulation of mitotic metaphase/anaphase transition (IEA) | GO:0030071

Domains

  • ( PF03256 ) Anaphase-promoting complex, subunit 10 (APC10)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00526690

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13411.17.999687362287465e-134anaphase-promoting complex, su
bunit 10 (223 aa)
OxytrichaContig1336.1.g1284.0006908853687255e-76Anaphase-promoting complex, su
bunit 10 (APC10)
DictyBaseDDB_G02689922.000214949834694e-50anapc10 on chromosome: 1 posit
ion 2080758 to 2081980
WormBaseWBGene000443452.0003218023735366e-33status:Partially_confirmed U
niProt:Q2WF61 protein_id:CCD
71733.1
Stentor CoeruleusSteCoe_232562.6102790696677047e-23
SGDYGL240W9.998720540547892e-23DOC1 Processivity factor requi
red for the ubiquitination act
ivity of the anaphase promotin
g complex (APC), mediates the
activity of the APC by contrib
uting to substrate recognition
; involved in cyclin proteolys
is; contains a conserved DOC1
homology domain

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000044

Sequences

>TTHERM_00526690(coding)
ATGAACGAAGGAAAAGAATACGTACAGATTTAGGGAAAGCCATAACCAAATAATTAAAGG
AGAGAAATAGGCGATGATGCTGTTTGGACTTTAAGTTCTGCAAAACCAGGAAATGGCGTA
GATTAGTTAAGAGATGGGGATGAAAAAACATTTTGGTAATCAGACGGTAATTAGCCTCAT
TTGATTAACATATAATTCCTTAAAAAAATGAGAGTTCAAGAAGTCGCAATGTATCTAGAT
TTTAAAACTGATGAGAGTTATACTCCAAGCAAGATATCTATAAGAGCAGGAACAAATTTA
TAAGATTTAAAGGAAAATGTATATGTTGAATTGGTAGAGCCTTCAGGATGGTATATTTTC
CCTTTAAAGACTAAATTACTTGATGAATCAGAAAAGCCATATATACTGACTATGAACCTA
TAAATTGCTATTTTGCAAAACTAGCACAGCGGTAAAGATACTCACATAAGGCAAGTTTTA
GTGTTTGGCCCGAGAGAAAAGTAGAACCAAGGTTTAGGTTTTCCTGATTTTAAAAGCCCA
GAAATTACTTAATACTACTCAATTAGATGA


>TTHERM_00526690(protein)
MNEGKEYVQIQGKPQPNNQRREIGDDAVWTLSSAKPGNGVDQLRDGDEKTFWQSDGNQPH
LINIQFLKKMRVQEVAMYLDFKTDESYTPSKISIRAGTNLQDLKENVYVELVEPSGWYIF
PLKTKLLDESEKPYILTMNLQIAILQNQHSGKDTHIRQVLVFGPREKQNQGLGFPDFKSP
EITQYYSIR


>TTHERM_00526690(gene)
ATGAACGAAGGAAAAGGTTAGTAGTTATTTAAAAGTTATACTTGAATGCATTAATCAATA
AAATATTATTTTTAAATTTAGAATACGTACAGATTTAGGGAAAGCCATAACCAAATAATT
AAAGGAGAGAAATAGGCGATGATGCTGTTTGGACTTTAAGTTCTGCAAAACCAGGAAATG
GCGTAGATTAGTTAAGAGATGGGGATGAAAAAACATTTTGGTAGTAATATTGTTTATTTA
TTGGCATGTTTAAGTTAAATTTTCGCTAAAATTAGATCAGACGGTAATTAGCCTCATTTG
ATTAACATATAATTCCTTAAAAAAATGAGAGTTCAAGTAAATTATAAAGTTTAGCAGTTT
AGAGTTTAGGAAATTAAATTACATAAATTATAGGAAGTCGCAATGTATCTAGATTTTAAA
ACTGATGAGAGTTATACTCCAAGCAAGATATCTATAAGAGCAGGAACAAATTTATAAGAT
TTAAAGGTAAAGCGACATTAAAGTTAAAAATTTGAAAATAAATAAAATAATCATCATCAA
AATTAAAAGGAAAATGTATATGTTGAATTGGTAGAGCCTTCAGGATGGTATATTTTCCCT
TTAAAGACTAAATTACTTGATGAATCAGAAAAGTAAATAAATAAATAAAATGATCTTTGA
AATACTCTTATTTCTAAATTTATTTTAAATTTATTAAATAAATAGGCCATATATACTGAC
TATGAACCTATAAATTGCTATTTTGCAAAACTAGCACAGCGGTAAAGATACTCACATAAG
GCAAGTTTTAGTGTTTGGCCCGAGAGAGTAAAATAAAAATATTTCGAATTTGAAATTATA
TAATTTTTTTAAAGAAAGTAGAACCAAGGTTTAGGTTTTCCTGATTTTAAAAGCCCAGAA
ATTACTTAATACTACTCAATTAGATGA