Identifiers and Description

Gene Model Identifier

TTHERM_00824040

Standard Name

APC1 (Anaphase promoting complex subunit 1)

Aliases

PreTt20472 | 141.m00129 | 3682.m00063

Description

Anaphase promoting complex subunit 1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.8%

TetraMine Data

TTHERM_00824040

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18128.19.997093137033517e-262hypothetical protein (1983 aa)
OxytrichaContig19644.0.1.g189.997093137033517e-262Proteasome/cyclosome repeat
DictyBaseDDB_G02853499.997751616309157e-110anapc1 on chromosome: 4 positi
on 3135215 to 3142138
Stentor CoeruleusSteCoe_145614.834541638053336e-68
WormBaseWBGene000031332.9997246065828143e-59locus:mat-2 status:Partially
_confirmed UniProt:O18191
protein_id:CAB16467.2
SGDYNL172W9.99893167504554e-35APC1 Largest subunit of the An
aphase-Promoting Complex/Cyclo
some (APC/C), which is a ubiqu
itin-protein ligase required f
or degradation of anaphase inh
ibitors, including mitotic cyc
lins, during the metaphase/ana
phase transition; component of
the platform domain of the AP
C/C, based on structural analy
sis

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00824040(coding)
ATGCATCACGGACACTAAACTTCTCCAGAAAAGATTTAAACTTTTATGAATAGAAATCCA
TTTGCGACAGATACTGTGATCTTAGATAATTAGGAGAATTTATTGGAAAAAGATGATAAT
AAAATTAGTTGCTTTTTTGCAGAAATAAATGATTTATCTGAGGATTTGAAATATAAAAGA
GTTTAATATGATCCATCTTCAAAAAAGGATAGCATTTATAAAAATAGAGAATTTAACTGC
ACATGCTAACTTTAAGATAAGGGGATTATGATTATGTCTTAAGGTGGTTCTTCCTTTCAT
CTTCCTTTAGAGCAAGATGTACAAGCAGTCCATCCTATGACAGAAGGCCTAATAATTTAA
TTTCAAATTAAAAAAGAAATCAAGTTTAATGATATTATGATGATGAATAGAGGTTTTTCA
AATAGAAATTAATTTGCTATGTAAGAAGAGTTCATTAATTTTGGAGTGGGTAATTAATTA
GGAGGAGTTAATAGTATGTCTGAAAATTAATTGTATTCTTATGTGACATTAAATAAGCAT
CCTTTGAACTCTCTAAAAGTATTAGGTATTTTGAAGAGAAGTGACGAGTCTATAATTCCT
TGGTTAGAAAGCTATGAAAAAATAGTTTATGTATCAAAAGATTTACCTATCCTAGTAAGT
TACAATAGGATTCATTAAAGGCATGCTATTCATGTTATTAGAGCTAACATTGAGGAAAGC
GAAAAGGAAAATACTAAACTGAATTTAACAAATAATTTCTATAGCCTTACTCACTTTAAC
GATTTAAGTTAGGGATTCTTTCCATCCTCTTCTTCTGCAGCAGCTCTTGGTATTCCAAAT
TCTTAAATAGTAACAGAGATATTTTTTGAAGAAAGCATTAAAGTAAACATGATGGAAAAA
TGTTAGATAATCAAAACAAATAACTATGGAGAATTTTTGATAGCTATGCTTATATTCGAC
ACAACATGCTATTTGAAATTATATTCTCTATCTTTTATTAACAATACATAAGCTTTAGAC
ACAACAAACTTCTAAGTTAATGCACTAAAAAATTTTGTTATCATAAATGACGTAGTTGAC
TTCTACCCTTTCAACCTTTTTTAAAATGAAGTTTCTATCCCTGTTATTTCTGATATTTAA
AAATAGATTTAAAGAAGAAGAAACGATAAGTTTAACTAGCTAAAAGTTCTACTCTCAAAT
GAATGTAAATTAAAATCTGGAATACTTACTCTCCATAAAAATGGCTCTTTCCAACTTCAT
AATGGGTTAATGAAGAGCTTAATCAAATTCGATATTTAATTTCCCTCTGTGATACCAGGA
AGTTTCAGACAGATTAAGAATATATCTGAATTTAAAAATGGGAGTGCTTAATTATAATTT
AGTGATGGACAGAAACTTCATATGAAGATCTCTCCTCAAATTTAATCTCCTTTGATTACA
ATCATAATGAATACTCTATAGCATATTTTAGATACTGAATTATATCATAAAATGCTTTCT
GATGTTTTCAGAAACTGCATAGATTTAAATGGGTTCATTTTACCAGAAAATAAATACCAG
GTTAATAATTCAGCCAATTTATTTTAGCAAACTAGCAAAAATACTAATGAAGAGTTTCAT
AATTTTTTGTGCTACTTCATTTATCTTCTGAAAATATGCAATAAGAATGTTCATGTTGGA
TAAAGTACTAAGGTTCAAGAAGAAGAAGGTTTGTTAAAAAAAGTAAAATAATAGCAATCA
CAGTCTTAGATTCTTATGGAATAGTATATGTAGTAACCTAGTAGTTCCATTTCAGGATAG
CAAGCAGTACCACCAGGTTTAGCTTAATCTTTGAATATATAAGTAGGGAATGCTCCATAG
AATATTATAAATCAAACTAATGGAGTTTCAAATGTTAGAAATTAATGTAAAAATTGGAAT
AAACTTCTTATGTCTAATTATCATCAAAAAAATTTTGAATTAAACAATCAACTTTTTAAA
AATCCTCCTAATTTTGTAATTCCTGATAGCCAAGCTAATTTTCCTATAAGTTAAGAGATG
GGTACTTAAGCTTAAGCAAACCCCCCAGCATAAAAACCAACTCATCATAGAAGATCATCA
GACATGCCATTCAATTCTGATTAAGGAGGTGCTTATGGATCTAACATTTATAATGCAAAC
AATAGTAATATGGCCTAAAGTAATAGTAACAGTGGGACTTAATAACCTCTTTTTAATAGT
AAAATTGAAGTGAATGTTGATAAATTTTATGAATAAAGGATTAGAATTTTAAGAATTTTA
AATTTATTGTATCAAGATATGAAAATATAAACAATATATAAAGAATATAGAGAAAATTTA
GCTTATTTTTTATATTGCTATTGCACTTATTTAGATTTTGAGTATAGCTCTAGTTATTAA
GACTATTATGTTAGAGAATTCCCATAAATTTTGATTAGATATCAAACAGATGTAAGGCTT
TAATAGCTTTAAATCTAATTCCATTACTAAAAGAATTTAAATTGGAATAAAGGAAGTACT
GCAAATACAAATTATCCTGAGAGCTTGTTCATAGAAAAAGATGTTCCTGATATTTTCAAG
TGGATTAACTATTTATTTACTTCTGATAACCAAACATAAAAAGTAGAATAAATCATGCCA
ATAATGTTTAAAAATACTTAAAAAATTTGTAAAATATTCGAATTAATGTAATTGGGTTTA
AACGCATCTCGAACTAAAATATCTGACTTAATTAAAAATAAAGCTTAAAATTTAAATAAC
ACTATTGGCTTTTAAATGCATGGCTATGGAAATTTAACTAACCCTTCTTTCCCTCTTTTC
CACTAAAAAGTTTTTTATATGAAATTCTTTGATTAAGAGAAAGACAAAAAAAATGCTAAA
TTCTCAAAAATATAAGAAATCTTTCGTGATTAAAACGAAATCCTTGTATTTTTATATCTT
ATTAAGAAGAACATAGATTAGGATTTCATTGAATCTCTCTCCTTTGGATTAAAAGCTCCT
ATTTATGAGTCATTGCGTCTCCTCAAACTTAATCTTCCTCCTCAATTATATGATATTACT
ACAAAAGAAGGTTTTAAAATGATCAAAAGAGAAGATATCTTCTAAAATAGATAGATTTAT
ATAAAAAAGAAAAATGAATTACCTGCATATCTTTCAAAAGTCGATTTCTCATAAACTATT
AATAACTTAATCAGAGGAACTAAAAATAATTAAGAGTAGTACATATTGTATGATGCTCAT
TTGCACAAATAAAACAATGAGTTGATTTTCGAAGAAGTAAACAGATTGCTTGATACTACT
AAAGATATTTAAATCAAATAAAAATACGTTGAAGATATCAGCGAAGAAGCTTTTGAAGTG
GAATCCTAAAATGTTTTAAGAAAATTTGTTACTAGAAGATTTTCTTGTTTGGTTGGTTAA
GGAGGATTCAACTTTGGTTCTTGGTCTACTTACATGACAGAGATAGTTAAAGTACCTAAA
ATAAATTTGAGTGCTGTTATGCCTAATGATATTAAAGTGACATTAGACACAAAAGATGAA
AAAGATTTGAACATGTGTTTGTGGCCAGAATTCCATAATGGGGTTGCTACTTCTTTAAAG
CTATCAAAGTCTGTAATGAATATGAACTCTGAAAATTTAAAGACTTGGATATTTTACTAA
AAACCAGAAAATGTTGAGTATGACCATGGTGGCTTCCTTCTTGGATTAGGGCTTTTAGGA
TATCTTGATTGTTTATCTCCTACTGATATCTTTTAATATCTAAAACCTAACCATGAAGCA
ACTTCTGTTGGTATTTTGCTAGGTATAGCTGCATCTAGGATAGGTAAATCTGACGATTCA
ACTTCTAAAACATTGTGTCTTCATATTCCATTCTTGCTTCCACCTTCTTATGATGTAGAA
ATTCCTCTTAATGTTTAAACAACTGCTCTTATTGGAGTAGGTTTGATTCACAAAGGAACA
AGTAATAGACTGATTACAGAAATGACTTTAGCATAAATAGGCAGAAAACCTTTAAGCGAT
AAGTGTTTAGATAGGGAAGGTTACTCTCTAGCTGCAGGCTTTTCACTTGGTTTAATTAAT
CTAGGAAAAGGAGCTTAACATACTAATATAAAAGATTTAGAACTTGAAGAGAGACTTATT
CGTTTCATTGAAGGTGGTAAAATAATGGATCCTCCATAGAGTATGCTTAGCACGAATTTC
AATACTGAAAACAAAAGTAGCAGTATTAAAGAAGGAAATACAGTAAATACTCATGTTACT
GCCCCAGGTGCTCTTATAGCAATTTCTCTTCTATTTTTAAAATCAAATGATATTAAAGTT
GCAGAAAAAATAACAATTCCAAATTCATTTTCAACTATTGAAAATTGCAATCCAAACAAT
ATTCTATTAAAGGTAATGGCAAAGAATATCATCATGTGGGACTAAATATCTAACACTAAA
GAATTCATTTATAACTAAATTCCAGAATTAATTAGATTTATTTATGAAAAATCATTTAAA
GAAGTATACTAGAGATACTATCTGGTTTACAATGTCTATGAAATTGATTTTAGTACTGTT
ACTAGCGTGTATTTAAATATTATTGGTGGTTGTATAATGGCTATTGGGTTGAAGTATGCA
GGCACTGGAGATAAAAAAGCAGTTGAAGTTATTATAAATGAAATAAGTAAAATGAGAAAG
CTTAAAACCTCAAAATGTGATTTAGTTAATGATCCTTCTGCAAAATCTTTGATTGATTAG
TATACACTATTTATACTTTATTCTGTTTCTGTACTTTCTTTGAGTTTGGTAAATGCAGGA
ACTTGTGATACCCACTCAATTAAAATAGCAAGAGTTATAAGAAAAAAATTCTAAGATTCT
GGTACATTCCATTATGGATTTAATATGGCTATTAACATGGCTATTGGCTTTTTAACTCTT
GGTCATGGAAATTACTCATTTAATAGAGATGATATGTCAATAGCTGCTTTATTAATTTCT
ATCTATCCATACTTCCCTAACTCTCCTTCAGATAATAAATATCACTTATAAGCTCTCAGG
CACTTCTATGTTCTTGCAGTTGAATAAAAGGTTTTCCATGCTGTTTCAACTGATGAAAAA
AAAGTAGTTAATGTCCAAGTTGAGCTTAAATATTTAGCAAATGAATGTATTTAGGTTGAG
AAATAATTTACCCCTATATTGTTATAAGAATCTAAAAAGATACTCAGTGTTAAGGTAGTA
GACGATGAATATTATGGCTTTGAAATAGATTTTGCAATGAATTAAAAAAATCCTAAGGTT
ATTTACGTTAAACGTAAGTATTCAGTTTAAAATAGCTAAGCAATTTTATCAGAAATAGAT
TCTTACGAAGAAAAAAAGAGACTTTAAGAATATATGAAATAAATACCTTACGACAAAGCT
TTCAAGCTTCTTGAAAAGAAAAATTTTGTAATTACTAAAAACTAATTAGACTATATTCTT
CCTTTTAGAAATAAGATTAACTAAGATAAGTCAAGTGCTTTAGTTAAGCATTTAGATTAG
CTTGACACTTTATATAGTTAAATCAACTAAATGATTTAAGACAAAGAGAATCAGATTTGT
CCATATGATGATCAACTGTAAATAGAATAGCTTATTTAACTCTGCATTTAAGAAGATAGA
CTAGAGTTAATAGAGCAATAATTACATCTTCTCAAAGATTTCAAATCTTTTATGAATATG
GATTGCATTTACCTTTAAAACATAAATATTCTTATCAACTTCTATGAAAATTAAAAAGGA
ATTAAAGGAATGTAATTGCAATCAAGTCAGCTTTTCAATCCTTAAAAGATCAATTTAATG
TAGTACAAACTCTATAAATATTTTATAGACTCTTATATTTTAAATAACCAAGATTAAAAA
GCTAAAGATTTAATTGTTAGTTATTTCACTTAGCCTGAAAATTTCTAGCTAGAAAGAATC
GACTTATCAGACTTCCCTACCTTACAAAAACTGATGAAATTAAATACTGTGTTAAATACA
CCAACCAAATAGGATTTATTATTAATAAAAAAATTCTTTGATAAGCTAACTACGATAGGG
TAAGTTCAAATTAAAGATGAAAAAGAAAAGCTTTGGAGTATATGTTAAATGTGCTTATTT
ATGTCATTCCCCTTATGTCCTTAGGATTTACTAAATACTATAACATAATTATATTTAGGC
AGCAACGATGAATAACAATCAACTGCAGATAATAACTCCTCAGCTACTGCTTAAACAGTA
AATAACTAATAAAATTAATAGAACTCTTCCAATTGA


>TTHERM_00824040(protein)
MHHGHQTSPEKIQTFMNRNPFATDTVILDNQENLLEKDDNKISCFFAEINDLSEDLKYKR
VQYDPSSKKDSIYKNREFNCTCQLQDKGIMIMSQGGSSFHLPLEQDVQAVHPMTEGLIIQ
FQIKKEIKFNDIMMMNRGFSNRNQFAMQEEFINFGVGNQLGGVNSMSENQLYSYVTLNKH
PLNSLKVLGILKRSDESIIPWLESYEKIVYVSKDLPILVSYNRIHQRHAIHVIRANIEES
EKENTKLNLTNNFYSLTHFNDLSQGFFPSSSSAAALGIPNSQIVTEIFFEESIKVNMMEK
CQIIKTNNYGEFLIAMLIFDTTCYLKLYSLSFINNTQALDTTNFQVNALKNFVIINDVVD
FYPFNLFQNEVSIPVISDIQKQIQRRRNDKFNQLKVLLSNECKLKSGILTLHKNGSFQLH
NGLMKSLIKFDIQFPSVIPGSFRQIKNISEFKNGSAQLQFSDGQKLHMKISPQIQSPLIT
IIMNTLQHILDTELYHKMLSDVFRNCIDLNGFILPENKYQVNNSANLFQQTSKNTNEEFH
NFLCYFIYLLKICNKNVHVGQSTKVQEEEGLLKKVKQQQSQSQILMEQYMQQPSSSISGQ
QAVPPGLAQSLNIQVGNAPQNIINQTNGVSNVRNQCKNWNKLLMSNYHQKNFELNNQLFK
NPPNFVIPDSQANFPISQEMGTQAQANPPAQKPTHHRRSSDMPFNSDQGGAYGSNIYNAN
NSNMAQSNSNSGTQQPLFNSKIEVNVDKFYEQRIRILRILNLLYQDMKIQTIYKEYRENL
AYFLYCYCTYLDFEYSSSYQDYYVREFPQILIRYQTDVRLQQLQIQFHYQKNLNWNKGST
ANTNYPESLFIEKDVPDIFKWINYLFTSDNQTQKVEQIMPIMFKNTQKICKIFELMQLGL
NASRTKISDLIKNKAQNLNNTIGFQMHGYGNLTNPSFPLFHQKVFYMKFFDQEKDKKNAK
FSKIQEIFRDQNEILVFLYLIKKNIDQDFIESLSFGLKAPIYESLRLLKLNLPPQLYDIT
TKEGFKMIKREDIFQNRQIYIKKKNELPAYLSKVDFSQTINNLIRGTKNNQEQYILYDAH
LHKQNNELIFEEVNRLLDTTKDIQIKQKYVEDISEEAFEVESQNVLRKFVTRRFSCLVGQ
GGFNFGSWSTYMTEIVKVPKINLSAVMPNDIKVTLDTKDEKDLNMCLWPEFHNGVATSLK
LSKSVMNMNSENLKTWIFYQKPENVEYDHGGFLLGLGLLGYLDCLSPTDIFQYLKPNHEA
TSVGILLGIAASRIGKSDDSTSKTLCLHIPFLLPPSYDVEIPLNVQTTALIGVGLIHKGT
SNRLITEMTLAQIGRKPLSDKCLDREGYSLAAGFSLGLINLGKGAQHTNIKDLELEERLI
RFIEGGKIMDPPQSMLSTNFNTENKSSSIKEGNTVNTHVTAPGALIAISLLFLKSNDIKV
AEKITIPNSFSTIENCNPNNILLKVMAKNIIMWDQISNTKEFIYNQIPELIRFIYEKSFK
EVYQRYYLVYNVYEIDFSTVTSVYLNIIGGCIMAIGLKYAGTGDKKAVEVIINEISKMRK
LKTSKCDLVNDPSAKSLIDQYTLFILYSVSVLSLSLVNAGTCDTHSIKIARVIRKKFQDS
GTFHYGFNMAINMAIGFLTLGHGNYSFNRDDMSIAALLISIYPYFPNSPSDNKYHLQALR
HFYVLAVEQKVFHAVSTDEKKVVNVQVELKYLANECIQVEKQFTPILLQESKKILSVKVV
DDEYYGFEIDFAMNQKNPKVIYVKRKYSVQNSQAILSEIDSYEEKKRLQEYMKQIPYDKA
FKLLEKKNFVITKNQLDYILPFRNKINQDKSSALVKHLDQLDTLYSQINQMIQDKENQIC
PYDDQLQIEQLIQLCIQEDRLELIEQQLHLLKDFKSFMNMDCIYLQNINILINFYENQKG
IKGMQLQSSQLFNPQKINLMQYKLYKYFIDSYILNNQDQKAKDLIVSYFTQPENFQLERI
DLSDFPTLQKLMKLNTVLNTPTKQDLLLIKKFFDKLTTIGQVQIKDEKEKLWSICQMCLF
MSFPLCPQDLLNTITQLYLGSNDEQQSTADNNSSATAQTVNNQQNQQNSSN


>TTHERM_00824040(gene)
ATGCATCACGGACACTAAACTTCTCCAGAAAAGATTTAAACTTTTATGAATAGAAATCCA
TTTGCGACAGATACTGTGATCTTAGATAATTAGGAGAATTTATTGGAAGTAATTATTTTA
AGTTTTAAAAAAAATGTTCCAGTCTAGGACTTACGCAAAATAAAATTTAGAGCACATGGA
TGAGTTAATTAATTATTTAAAAAATAAATTTAATAGAAAGATGATAATAAAATTAGTTGC
TTTTTTGCAGAAATAAATGATTTATCTGAGGATTTGAAATATAAAAGAGTTTAATATGAT
CCATCTTCAAAAAAGGATAGCATTTATAAAAATAGAGAATTTAACTGCACATGCTAACTT
TAAGATAAGGGGATTATGATTATGTCTTAAGGTGGTTCTTCCTTTCATCTTCCTTTAGAG
CAAGATGTACAAGCAGTCCATCCTATGACAGAAGGCCTAATAATTTAATTTCAAATTAAA
AAAGAAATCAAGTTTAATGGTAAGCATTTAAAAAATTTCAAATGAAAACTTGAATAAATT
TCTAGCTCAATTAACTTATTTTTACAATAATATTTGTAATTAAGATGAAAATAATATTTT
AAATTAAAGATTTTCATTGAAATTTTCTGAGCTTTTAACAGAATTATTTGCAAATAATAT
CAATCATTTTATAGAAATAGATAATTTATAAGCAAATTTTAAATGAATTTAAAAATAAGA
AGAAGTTAAATAATAAAATTTCTAAAATTAAATTTTTGGATTGTAATACGTTATTAATTT
ATTTATTATTTTTTAAATATAAGATATTATGATGATGAATAGAGGTTTTTCAAATAGAAA
TTAATTTGCTATGTAAGAAGAGTTCATTAATTTTGGAGTGGGTAATTAATTAGGAGGAGT
TAATAGTATGTCTGAAAATTAATTGTATTCTTATGTGACATTAAATAAGCATCCTTTGAA
CTCTCTAAAAGTATTAGGTATTTTGAAGAGAAGTGACGAGTCTATAATTCCTTGGTTAGA
AAGCTATGAAAAAATAGTTTATGTATCAAAAGATTTACCTATCCTAGTAAGTTACAATAG
GATTCATTAAAGGCATGCTATTCATGTTATTAGAGCTAACATTGAGGAAAGCGAAAAGGA
AAATACTAAACTGAATTTAACAAATAATTTCTATAGCCTTACTCACTTTAACGATTTAAG
TTAGGGATTCTTTCCATCCTCTTCTTCTGCAGCAGCTCTTGGTATTCCAAATTCTTAAAT
AGTAACAGAGATATTTTTTGAAGAAAGCATTAAAGTAAACATGATGGAAAAATGTTAGAT
AATCAAAACAAATAACTATGGAGAATTTTTGATAGCTATGCTTATATTCGACACAACATG
CTATTTGAAATTATATTCTCTATCTTTTATTAACAATACATAAGCTTTAGACACAACAAA
CTTCTAAGTTAATGCACTAAAAAATTTTGTTATCATAAATGACGTAGTTGACTTCTACCC
TTTCAACCTTTTTTAAAATGAAGTTTCTATCCCTGTTATTTCTGATATTTAAAAATAGGT
ATTCATTTAATTAATTAATAAGTTGATTAAAATTTCTTTAAAATAGTTCAAAATTAAAAT
AAATTATTTTAAATTAAATTTAAATTGTTTAAAATAAAAATATATTAAAAATTTAATGAA
TGAAATTGATGATAATCCTTTAATAAAAATAGATTTAAAGAAGAAGAAACGATAAGTTTA
ACTAGCTAAAAGTTCTACTCTCAAATGAATGTAAATTAAAATCTGGAATACTTACTCTCC
ATAAAAATGGCTCTTTCCAACTTCATAATGGGTTAATGAAGAGCTTAATCAAATTCGATA
TTTAATTTCCCTCTGTGATACCAGGAAGTTTCAGACAGATTAAGAATATATCTGAATTTA
AAAGTAATATCAAAAATATATTTAGAAATATGGAGTATTATAATAAAATATTTGAATATA
ATTAGATGGGAGTGCTTAATTATAATTTAGTGATGGACAGAAACTTCATATGAAGATCTC
TCCTCAAATTTAATCTCCTTTGATTACAATCATAATGAATACTCTATAGCATATTTTAGA
TACTGAATTATATCATAAAATGCTTTCTGATGTTTTCAGAAACTGCATAGTAATTAATTA
TTATTATCATTTTTTATATTTTATAAAATATCAAATTATTAAAATAAATATATAGGATTT
AAATGGGTTCATTTTACCAGAAAATAAATACCAGGTTAATAATTCAGCCAATTTATTTTA
GCAAACTAGCAAAAATACTAATGAAGAGTTTCATAATTTTTTGTGCTACTTCATTTATCT
TCTGAAAATATGCAATAAGAATGTTCATGTTGGATAAAGTACTAAGGTTCAAGAAGAAGA
AGGTTTGTTAAAAAAAGTAAAATAATAGCAATCACAGTCTTAGATTCTTATGGAATAGTA
TATGTAGTAACCTAGTAGTTCCATTTCAGGATAGCAAGCAGTACCACCAGGTTTAGCTTA
ATCTTTGAATATATAAGTAGGGAATGCTCCATAGAATATTATAAATCAAACTAATGGAGT
TTCAAATGTTAGAAATTAATGTAAAAATTGGAATAAACTTCTTATGTCTAATTATCATCA
AAAAAATTTTGAATTAAACAATCAACTTTTTAAAAATCCTCCTAATTTTGTAATTCCTGA
TAGCCAAGCTAATTTTCCTATAAGTTAAGAGATGGGTACTTAAGCTTAAGCAAACCCCCC
AGCATAAAAACCAACTCATCATAGAAGATCATCAGACATGCCATTCAATTCGTAAAATAA
AATTTTAAACAATATTTAAATTAAAATATTTTTAAAAACTTTGATTTTGCATAAATAGAA
ATTTATAAATTAAGTTTTAATTAAATTATAAAAAAGTGATTAAGGAGGTGCTTATGGATC
TAACATTTATAATGCAAACAATAGTAATATGGCCTAAAGTAATAGTAACAGTGGGACTTA
ATAACCTCTTTTTAATAGTAAAATTGAAGTGAATGTTGATAAATTTTATGAATAAAGGAT
TAGAATTTTAAGAATTTTAAATTTATTGTATCAAGATATGAAAATATAAACAATATATAA
AGAATATAGAGAAAATTTAGCTTATTTTTTATATTGCTATTGCACTTATTTAGATTTTGA
GTATAGCTCTAGTTATTAAGACTATTATGTTAGAGAATTCCCATAAATTTTGATTAGATA
TCAAACAGATGTAAGGCTTTAATAGCTTTAAATCTAATTCCATTACTAAAAGAATTTAAA
TTGGAATAAAGGAAGTACTGCAAATACAAATTATCCTGAGAGCTTGTTCATAGAAAAAGA
TGTTCCTGATATTTTCAAGTGGATTAACTATTTATTTACTTCTGATAACCAAACATAAAA
AGTAGAATAAATCATGCCAATAATGTTTAAAAATACTTAAAAAATTTGTAAAATATTCGA
ATTAATGTAATTGGGTTTAAACGCATCTCGAACTAAAATATCTGACTTAATTAAAAATAA
AGCTTAAAATTTAAATAACACTATTGGCTTTTAAATGCATGGCTATGGAAATTTAACTAA
CCCTTCTTTCCCTCTTTTCCACTAAAAAGTTTTTTATATGAAATTCTTTGATTAAGAGAA
AGACAAAAAAAATGCTAAATTCTCAAAAATATAAGAAATCTTTCGTGATTAAAACGAAAT
CCTTGTATTTTTATATCTTATTAAGAAGAACATAGATTAGGATTTCATTGAATCTCTCTC
CTTTGGATTAAAAGCTCCTATTTATGAGTCATTGCGTCTCCTCAAACTTAATCTTCCTCC
TCAATTATATGATGTAAATTTAATACATTTTATTTTTTTTAAATTGACAAAAATGTTTCT
TATCTTGATAGATTACTACAAAAGAAGGTTTTAAAATGATCAAAAGAGAAGATATCTTCT
AAAATAGATAGATTTATATAAAAAAGAAAAATGAATTACCTGCATATCTTTCAAAAGTCG
ATTTCTCATAAACTATTAATAACTTAATCAGAGGAACTAAAAATAATTAAGAGTAGTACA
TATTGTATGATGCTCATTTGCACAAATAAAACAATGAGTTGATTTTCGAAGAAGTAAACA
GATTGCTTGATACTACTAAAGATATTTAAATCAAATAAAAATACGTTGAAGATATCAGCG
AAGAAGCGTAAACTACTCAATAATTTCTTATTATTATAAATTTTAGCATTTTATTATGTA
TTATTTTAAATAAATTAATTCATAAAAATATATTCATTTTTAACAAATTTAATAAAATTA
ATCAATTAAAAATATAGTTTTGAAGTGGAATCCTAAAATGTTTTAAGAAAATTTGTTACT
AGAAGATTTTCTTGTTTGGTTGGTTAAGGAGGATTCAACTTTGGTTCTTGGTCTACTTAC
ATGACAGAGATAGTTAAAGTACCTAAAATAAATTTGAGTGCTGTTATGCCTAATGATATT
AAAGTGACATTAGACACAAAAGATGAAAAAGATTTGAACATGTGTTTGTGGCCAGAATTC
CATAATGGGGTTGCTACTTCTTTAAAGCTATCAAAGTCTGTAATGAATATGAACTCTGAA
AATTTAAAGACTTGGATATTTTACTAAAAACCAGAAAATGTTGAGTATGACCATGGTGGC
TTCCTTCTTGGATTAGGGCTTTTAGGATATCTTGATTGTTTATCTCCTACTGATATCTTT
TAATATCTAAAACCTAACCATGAAGCAACTTCTGTTGGTATTTTGCTAGGTATAGCTGCA
TCTAGGATAGGTAAATCTGACGATTCAACTTCTAAAACATTGTGTCTTCATATTCCATTC
TTGCTTCCACCTTCTTATGATGTAGAAATTCCTCTTAATGTTTAAACAACTGCTCTTATT
GGAGTAGGTTTGATTCACAAAGGAACAAGTATATATTTTTGTTATTCTTAACTCATTAAA
ATTAAAAAAAACTATTTGAATAAAGGTAATAGACTGATTACAGAAATGACTTTAGCATAA
ATAGGCAGAAAACCTTTAAGCGATAAGTGTTTAGATAGGGAAGGTTACTCTCTAGCTGCA
GGCTTTTCACTTGGTTTAATTAATCTAGGAAAAGGAGCTTAACATACTAATATAAAAGAT
TTAGAACTTGAAGAGAGACTTATTCGTTTCATTGAAGGTGGTAAAATAATGGATCCTCCA
TAGAGTATGCTTAGCACGAATTTCAATACTGAAAACAAAAGTAGCAGTATTAAAGAAGGA
AATACAGTAAATACTCATGTTACTGCCCCAGGTGCTCTTATAGCAATTTCTCTTCTATTT
TTAAAATCAAATGATATTAAAGTTGCAGAAAAAATAACAATTCCAAATTCATTTTCAACT
ATTGAAAATTGCAATCCAAACAATATTCTATTAAAGGTAATGGCAAAGAATATCATCATG
TGGGACTAAATATCTAACACTAAAGAATTCATTTATAACTAAATTCCAGAATTAATTAGA
TTTATTTATGAAAAATCATTTAAAGAAGTATACTAGAGGTAAATTGATTATTTTTATTAC
AAAAATAATAAAATTTTAATAAATAATATTAATGAAATAATTGAATAAATGAGAAGATAA
GTTAAATTAAAATACATTTTTAATCTAATACAAATTTTTTTTTTTTAATTAATAGATACT
ATCTGGTTTACAATGTCTATGAAATTGATTTTAGTACTGTTACTAGCGTGTATTTAAATA
TTATTGGTGGTTGTATAATGGCTATTGGGTTGAAGTATGCAGGCACTGGAGATAAAAAAG
CAGTTGAAGTTATTATAAATGAAATAAGTAAAATGAGAAAGCTTAAAACCTCAAAATGTG
ATTTAGTTAATGATCCTTCTGCAAAATCTTTGATTGATTAGTATACACTATTTATACTTT
ATTCTGTTTCTGTACTTTCTTTGAGTTTGGTAAATGCAGGAACTTGTGATACCCACTCAA
TTAAAATAGCAAGAGTTATAAGAAAAAAATTCTAAGATTCTGGTACATTCCATTATGGAT
TTAATATGGCTATTAACATGGCTATTGGCTTTTTAACTCTTGGTCATGGAAATTACTCAT
TTAATAGAGATGATATGTCAATAGCTGCTTTATTAATTTCTATCTATCCATACTTCCCTA
ACTCTCCTTCAGATAATAAATATCACTTATAAGCTCTCAGGCACTTCTATGTTCTTGCAG
TTGAATAAAAGTAGCATATTTTACCTTCCTAATAATTTATGAAATAGAATAAAATAATTT
TTTAATTTAATAGGGTTTTCCATGCTGTTTCAACTGATGAAAAAAAAGTAGTTAATGTCC
AAGTTGAGCTTAAATATTTAGCAAATGAATGTATTTAGGTTGAGAAATAATTTACCCCTA
TATTGTTATAAGAATCTAAAAAGATACTCAGTGTTAAGGTAGTAGACGATGAATATTATG
GCTTTGAAATAGATTTTGCAATGAATTAAAAAAATCCTAAGGTTATTTACGTTAAACGTA
AGTATTCAGTTTAAAATAGCTAAGCAATTTTATCAGAAATAGGTAATCAAATTTAATAAA
ATAATTTAAAAGTCATTTTAATAAATTTGTTGAATTAGATTCTTACGAAGAAAAAAAGAG
ACTTTAAGAATATATGAAATAAATACCTTACGACAAAGCTTTCAAGCTTCTTGAAAAGAA
AAATTTTGTAATTACTAAAAACTAATTAGACTATATTCTTCCTTTTAGAAATAAGATTAA
CTAAGATAAGTCAAGTGCTTTAGTTAAGCATTTAGATTAGCTTGACACTTTATATAGTTA
AATCAACTAAATGATTTAAGACAAAGAGAATCAGATTTGTCCATATGATGATCAACTGTA
AATAGAATAGCTTATTTAACTCTGCATTTAAGAAGATAGACTAGAGTTAATAGAGCAATA
ATTACATCTTCTCAAAGATTTCAAATCTTTTATGAATATGGATTGCATTTACCTTTAAAA
CATAAATATTCTTATCAACTTCTATGAAAATTAAAAAGGAATTAAAGGAATGTAATTGCA
ATCAAGTCAGCTTTTCAATCCTTAAAAGATCAATTTAATGTAGTACAAACTCTATAAATA
TTTTATAGACTCTTATATTTTAAATAACCAAGTAATCAATTAATTATGCAAACATTTTTT
CATATTAAATTTCTTATTAATGTAAATATAAAGGATTAAAAAGCTAAAGATTTAATTGTT
AGTTATTTCACTTAGCCTGAAAATTTCTAGCTAGAAAGAATCGACTTATCAGACTTCCCT
ACCTTACGTAATATTTTATTTTCATATTTTAATATCAATTAATATTATTTTAAATAGAAA
AACTGATGAAATTAAATACTGTGTTAAATACACCAACCAAATAGGATTTATTATTAATAA
AAAAATTCTTTGATAAGCTAACTACGATAGGGTAAGTTCAAATTAAAGATGAAAAAGAAA
AGCTTTGGAGTATATGTTAAATGTGCTTATTTATGTCATTCCCCTTATGTCCTTAGGATT
TACTAAATACTATAACATAATTATATTTAGGCAGCAACGATGAATAACAATCAACTGCAG
ATAATAACTCCTCAGCTACTGCTTAAACAGTAAATAACTAATAAAATTAATAGAACTCTT
CCAATTGA