Identifiers and Description

Gene Model Identifier

TTHERM_00582140

Standard Name

APB11 (beta subunit of adaptor protein complex 1 (AP-1))

Aliases

PreTt25650 | 79.m00164 | 3827.m00880

Description

Adaptin N terminal region family protein, AP-1 beta subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00582140

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_118590
WormBaseWBGene000001609.997093137033517e-262locus:apb-1 status:Partially
_confirmed UniProt:Q7YZG8
protein_id:CCD72408.1
Tetrahymena borealisEI9_07418.19.997093137033517e-262adaptin N-terminal region fami
ly protein (1020 aa)
DictyBaseDDB_G02791419.997093137033517e-262ap1b1 on chromosome: 3 positio
n 1680228 to 1683328
OxytrichaContig10327.0.1.g1149.997093137033517e-262hypothetical protein
SGDYKL135C8.997677048217667e-123APL2 Beta-adaptin, large subun
it of the clathrin-associated
protein (AP-1) complex; binds
clathrin; involved in clathrin
-dependent Golgi protein sorti
ng

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00582140(coding)
ATGTCTTCAACTAGTTCATCAAAAAGTTCTTCTTCGAAGGGACCAGCTAATGTTAAAAAG
AATGAAATTTAGGAATTGCAAGATGATCTCATTAATAACAACGAGAATATAAAGAAGGAA
GCCGTCAGAAAAATTATTGATGCAATGACCAGAGGTAAAGATGTTTCTATGCTCTTCCCT
CACGTTTTAAGAAATATGATGACCAAGAATATGGAGTTAAAAAAATTGATATATTTATAC
ATCATTAATTATGCTAAAACAAAGCCTGATTTAGTTATTCTCGCCATCAATTCATTCAAG
AGTGATGCTTCAGATCCATCAAACCCCATGTTAAGAAGTTTAGCAGTAAGAACTATGGGT
TGTATTCGTGTTAAAGAAATTATAGAATACTTGTTGGATGCATTAAAAAAAGCAGTAAAA
GATGAAAACCCTTACGTCCGTAAGACCGCTGCAGTTTGTATAGCAAAAATCTATGAAACT
TATCCAGAATTAGTAGTTGAATAAGGTTTCTTATAGCAATTAGAATACCTTCTTAATGAT
AGCAATGCAATGGTTATTGCCAATGCAGTCTGTGCCTAAATGTAAATTTAAGATATAAAG
GGAGGAAATGTTTTGGAGCTAAATAAATTCAAAGTTTAAAAATTAAGAACTGCAATGAAC
GAATGCAACGAATGGGGTGTCATTTATATTCTTGACGCTCTTGCCGTTTACCGTCCTGAT
GACACCAAAGAGGCAGAAGATATTTTAGAAAGAGTTATTCCAAGATTGTCTCACTAAAAT
CCAGGAGTTATTTTGAGTGCTACTAGAGTTATCATGAAATATTTAGACTACTTAACTGAC
CCTGAAATGGTTATTAACTATTGCAAGAAACTAACCAGTCCTTTAATTAGTTTATTGAAT
ATGGAACCTGAAATCGTATTTATTGCTTTAAAAAATATCAATTTAATTCTATAGAAGAGA
CCTATCATTATTGAGAAGGAAATTAAATTCTTCTTCTGTAACTTTAACGATCCCATCTAC
ATCAAAGTTATGAAAATTGAAATTCTTATTCGTCTAGCTAACATTGATAATATTCCTTAA
ATTCTTCACTAATTAAAAGAATATTCAGCAGAAGTAGATATTGAAATAGCCAAAAAGTCT
ATCAGAGCTATTGGTAGATGTGCTATCAAGTTAGAAAAAGCAGCCCAAAAATGTGTTTAG
GTTTTAAGAGACTGCTTAAGATCAAAGGATGACTACGTTACTTAGGAAACTATTATAGTT
ATTAGAGATATTTTTAGAAAATATCCTAAAGATTATGAAGGTTTGTTAAAAGAAATATGC
GAAAATTTAAAGACTTTAGATAATCCTGAAGCTAAGGCTGCCATGATTTGGATTATTGGT
GAATATGTTGACACCATTGAAAACTCTGGCTCACTTCTTGAAGAATTCGTTAAGAGCTTT
ATTGAAGAACCAGCTATCGTTTAGCATTAAATTTTAACTAGTTGTGTTAAATTGTTCTTG
ATGAGACCTTAAGATGGTTACGATTTAGTCCACAAATTATTACAATAAGCCACTAACAAT
TGTGAAAATCCTGATATCAGAGATAGAGGTTATATTTATTGGAGATTGCTTGGTTAAAGC
CCTGAATTAGCTAAAAAAATTGTTTACAGTGAACGTCCTGAAATTTCAGACAATACTTAT
GTATTGGAAACAGCTCTACTTGATAAGCTTATTGAAAATATTGGAACTCTCTCCTCTGTT
TACTACAAACCTCCTGAGCAGTTCGTTAAGCACTTAAGAGATATTATTAACCAAAAAGAA
ATGGAAGAAAATGAAGCAGAAGAAGCTGGTGATGAATTCTTCATTAAGGGTGAAAATAAT
GTAGCTGATAAAGATTACTATGGTGGGGAAGTTACGATTAATGATGATCAAGCTTAATAA
TAGCAATCAAATATTTAATATAATATGAATAGCAATATTTAAAATACTTAAATGTAATTA
AACCAAAGCAATATAAGCTCTACTCCCTCAACTGCTGCTACAGTTAACTAGAGTTAGGCT
AAAAATTTATTAGATGATGACGATGATATAATGGCTCCACCAATATAATAGTAATAATAT
AATTAGCCTCCTCCTTAAGTTTATTAATAGCCACCTCAATAACAATAACTCTAACCTGCC
CCTTCTTAGGCTAAGAATCTTCTTGATGACGATGATGATATCATAGGTGGAGCTAGCACA
GCACCTTAACCTCAATAGATAAATTAAATGCAATATAATTAATCTCCCTAAGCTGTCAAT
AGTAATTAATAAGCTAGTTTCAGCAGCAACGGTTCAAATTCAAATAATAATACAGACTTC
TTTGGGGGTGGCTCTTAATTAAGAGCTCCTAACATTAAAATACCTTTTAGCGAATGTGTA
AATGAAAATAAGTTCTCGATGAAAAATATAGTGAATGGATTAAATATTGCTTGTGCCTTC
TAAAGAGAGGGTGCCTAGATGTTTTTAGAAATTTAAGTTTCAAATCGTTTTGGAAATAAC
ACTTTCTCAGATTTCGCTATTAAACTTGCTCCAAACAAATTTAAAATAAACCCAACAACT
ATTGATCTTAACAAATTAGGATAGGTTGCCCCTGGTCAAACTAGCTCATGTAAAATTGAA
ATTGATTGTAATGGCTAAATTGATAATGGACCTTTGAGCAGCCCTTTCTTAGTAAATACT
ATGATAAAAACAAACTTTGATGTTTACTAAATGGCAATTCCTTGCAGTCTTTCAGTTTTA
ATCGTACCTGGAGCTCCTCTTTAAATCTAATAATATGGAGAATTCTCCTCTAGAATGGTC
AAAAAAGCTGATAAGATTCCCATGATTATTGATAGAGATGCACTTGTAAAGAAAATGGCC
AACAATAATATCTATTTTGTAAATTCTCAAACTAATCCTTAGGGAATTGAAATGATAAAC
TTCTCATGTAAGTTAGCTAACGAAATGCCACTTTTATTAGATGTAATTATAGATAAGATA
AATGGAGCACTTAATATTTAATATCACGCTCCTCACGACACTATTTTACCTCTTTTCTAT
TAAGCTATTATGTTCGTCTTAAAGTTCTGA


>TTHERM_00582140(protein)
MSSTSSSKSSSSKGPANVKKNEIQELQDDLINNNENIKKEAVRKIIDAMTRGKDVSMLFP
HVLRNMMTKNMELKKLIYLYIINYAKTKPDLVILAINSFKSDASDPSNPMLRSLAVRTMG
CIRVKEIIEYLLDALKKAVKDENPYVRKTAAVCIAKIYETYPELVVEQGFLQQLEYLLND
SNAMVIANAVCAQMQIQDIKGGNVLELNKFKVQKLRTAMNECNEWGVIYILDALAVYRPD
DTKEAEDILERVIPRLSHQNPGVILSATRVIMKYLDYLTDPEMVINYCKKLTSPLISLLN
MEPEIVFIALKNINLILQKRPIIIEKEIKFFFCNFNDPIYIKVMKIEILIRLANIDNIPQ
ILHQLKEYSAEVDIEIAKKSIRAIGRCAIKLEKAAQKCVQVLRDCLRSKDDYVTQETIIV
IRDIFRKYPKDYEGLLKEICENLKTLDNPEAKAAMIWIIGEYVDTIENSGSLLEEFVKSF
IEEPAIVQHQILTSCVKLFLMRPQDGYDLVHKLLQQATNNCENPDIRDRGYIYWRLLGQS
PELAKKIVYSERPEISDNTYVLETALLDKLIENIGTLSSVYYKPPEQFVKHLRDIINQKE
MEENEAEEAGDEFFIKGENNVADKDYYGGEVTINDDQAQQQQSNIQYNMNSNIQNTQMQL
NQSNISSTPSTAATVNQSQAKNLLDDDDDIMAPPIQQQQYNQPPPQVYQQPPQQQQLQPA
PSQAKNLLDDDDDIIGGASTAPQPQQINQMQYNQSPQAVNSNQQASFSSNGSNSNNNTDF
FGGGSQLRAPNIKIPFSECVNENKFSMKNIVNGLNIACAFQREGAQMFLEIQVSNRFGNN
TFSDFAIKLAPNKFKINPTTIDLNKLGQVAPGQTSSCKIEIDCNGQIDNGPLSSPFLVNT
MIKTNFDVYQMAIPCSLSVLIVPGAPLQIQQYGEFSSRMVKKADKIPMIIDRDALVKKMA
NNNIYFVNSQTNPQGIEMINFSCKLANEMPLLLDVIIDKINGALNIQYHAPHDTILPLFY
QAIMFVLKF


>TTHERM_00582140(gene)
ATGTCTTCAACTAGTTCATCAAAAAGTTCTTCTTCGAAGGGACCAGCTAATGTTAAAAAG
AATGAAATTTAGGAATTGCAAGATGATCTCATTAATAACAACGAGAATATAAAGAAGGAA
GCCGTCAGAAAAGTAAAAAAAAATTAATAAAAAAGGGAAAAATGAGGTTTTACATTTCCA
TAGAGGAGTTTAAAAGTTAGTTGAAAAATTTATTTTAGTATCAAGATCAACCTTCAAATT
AAAAGGCTACTCTATGTTGAAATGTGGCAGCAACCAAATAAATTAATTAGCATTAAATAA
TTCAATTTTGAATATTTTTTAATTATCCTAGATTATTGATGCAATGACCAGAGGTAAAGA
TGTTTCTATGCTCTTCCCTCACGTTTTAAGAAATATGATGACCAAGAATATGGAGTTAAA
AAAATTGATATATTTATACATCATTAATTATGCTAAAACAAAGCCTGATTTAGTTATTCT
CGCCATCAATTCATTCAAGAGTGTAATTTTACATTAATTGTACAGCTAAAAAAAAGAAAT
TTTGAATTGCTTTTAGTTTTAATTACTTTGCAGACAATTAAATATATTTTTTTAGAAGGA
ATTTTCAACAATGTTAATATAAATAGGATGCTTCAGATCCATCAAACCCCATGTTAAGAA
GTTTAGCAGTAAGAACTATGGGTTGTATTCGTGTTAAAGAAATTATAGAATACTTGTTGG
ATGCATTAAAAAAAGCAGTAAAAGATGAAAACCCTTACGTCCGTAAGACCGCTGCAGTTT
GTATAGCAAAAATCTATGAAACTTATCCAGAATTAGTAGTTGAATAAGGTTTCTTATAGC
AATTAGAATACCTTCTTAATGATAGCAATGCAATGGTTATTGCCAATGCAGTCTGTGCCT
AAATGTAAATTTAAGATATAAAGGGAGGAAATGTTTTGGAGCTAAATAAATTCAAAGTTT
AAAAATTAAGAACTGCAATGAACGAATGCAACGAATGGGGTGTCATTTATATTCTTGACG
CTCTTGCCGTTTACCGTCCTGATGACACCAAAGAGGCAGAAGAGTATTTACATATTTTAA
ATCCATTCATTTGTTTTCAAATAAATAAATTAATTGAGTGAATTTTGAATCACGCATAAA
ATTTTATTTATTTCAGAACACTCTACATTTAATTTAAAATTTTTGGAGCAAATCCGACAG
CTGGTCATTTCAACATAGCATTCAGAAAGCAAAATAAAATAAGTGCATATAAATTTAATT
AAATAAAATATCTATAATTTAATCTATTTCACTATTTTAAAAGAGACTAAGATGAAAATT
ATTCTTTAAAACTTAACTATTTATTAATAGACAGTCGAAAAACTTTGATTAAATTTATTT
TAAACATTCCTGCATTCAATCAATAATTTGGAATCTCCAATCTATTTTTAAACTAGGTTT
CTGAAATAAATCTACCTTTTAACAAACAAATAAACAATCAACAATCTAAATTTATGAATA
AAGATAATAAAAATAGATAAATAAGTAAATCAAACAATATAGTTTAAATAAAAAGAATTA
AATTAGTAATAATACAAAAGCATTATTAAAATAATTAAATTTTTGATGTAAAAGTTAGAC
CTATCAATCGCTTTTATGAATTTTAAATATTAAAGCATATTTAACTTATCAATAAATGAA
TTCAATTTTATTTTTTATAATTTTACAACCTTAACAATTAAAAATTAATATTAAAATAAA
ACAGTATTTTAGAAAGAGTTATTCCAAGATTGTCTCACTAAAATCCAGGAGTTATTTTGA
GTGCTACTAGAGTTATCATGAAATATTTAGACTACTTAACTGACCCTGAAATGGTTATTA
ACTATTGCAAGAAACTAACCAGTCCTTTAATTAGTTTATTGAATATGGAACCTGAAATCG
TATTTATTGCTTTAAAAAATATCAATTTAATTCTATAGAAGAGACCTATCATTATTGAGA
AGGAAATTAAATTCTTCTTCTGTAACTTTAACGATCCCATCTACATCAAAGTTATGAAAA
TTGAAATTCTTATTCGTCTAGCTAACATTGATAATATTCCTTAAATTCTTCACTAATTAA
AAGAATATTCAGCAGAAGTAGATATTGAAATAGCCAAAAAGGTAAATTAAATAAATAAAA
AAATAGATTTTTTTCTTCATAAAATAAGAAATAAGCAAATTTATTCAAATATAAATTAAT
GAATTATATTTTATTTATTTTACTTCAATTCACTTTCAGTCTGTCTTTAAATTATTTCTT
TGAATTAACCAATAATTTTTTATAATAAATAAATTAGTCTATCAGAGCTATTGGTAGATG
TGCTATCAAGTTAGAAAAAGCAGCCCAAAAATGTGTTTAGGTTTTAAGAGACTGCTTAAG
ATCAAAGGATGACTACGTTACTTAGGAAACTATTATAGTTATTAGAGATATTTTTAGAAA
ATATCCTAAAGATTATGAAGGTTTGTTAAAAGAAATATGCGAAAATTTAAAGACTTTAGA
TAATCCTGAAGCTAAGGCTGCCATGATTTGGATTATTGGTGAATATGTTGACACCATTGA
AAACTCTGGCTCACTTCTTGAAGAATTCGTTAAGAGGTAAATAAATAAATAAAATATACC
TTCATTTTTATCAAGAAAGTTTAGATTATTAAGTAATAAAATCAATTATTTTTTTAATAT
TTAGCTTTATTGAAGAACCAGCTATCGTTTAGCATTAAATTTTAACTAGTTGTGTTAAAT
TGTTCTTGATGAGACCTTAAGATGGTTACGATTTAGTCCACAAATTATTACAATAAGCCA
CTAACAATTGTGAAAATCCTGATATCAGAGATAGAGGTTATATTTATTGGAGATTGCTTG
GTTAAAGCCCTGAATTAGCTAAAAAAATTGTTTACAGTGAACGTCCTGAAATTTCAGACA
ATACTTATGTATTGGAAACAGCTCTACTTGATAAGCTTATTGAAAATATTGGAACTCTCT
CCTCTGTTTACTACAAACCTCCTGAGCAGTTCGTTAAGCACTTAAGAGATATTATTAACC
AAAAAGAAATGGAAGAAAATGTAATTTGATTTTTAATAAAATACTCAATTATAAATTGAA
ATGGCTAATAAATATTTAAATAAACAGATTGTTGAACAAATAAATCAATTTTTATTGTTG
TATTAAATAAATATATTTTATGTAAAATTGTTAATAGGAAGCAGAAGAAGCTGGTGATGA
ATTCTTCATTAAGGGTGAAAATAATGTAGCTGATAAAGATTACTATGGTGGGGAAGTTAC
GATTAATGATGATCAAGCTTAATAATAGCAATCAAATATTTAATATAATATGAATAGCAA
TATTTAAAATACTTAAATGTAATTAAACCAAAGCAATATAAGCTCTACTCCCTCAACTGC
TGCTACAGTTAACTAGAGTTAGGCTAAAAATTTATTAGATGATGACGATGATATAATGGC
TCCACCAATATAATAGTAATAATATAATTAGCCTCCTCCTTAAGTTTATTAATAGCCACC
TCAATAACAATAACTCTAACCTGCCCCTTCTTAGGCTAAGAATCTTCTTGATGACGATGA
TGATATCATAGGTGGAGCTAGCACAGCACCTTAACCTCAATAGATAAATTAAATGCAATA
TAATTAATCTCCCTAAGCTGTCAATAGTAATTAATAAGCTAGTTTCAGCAGCAACGGTTC
AAATTCAAATAATAATACAGACTTCTTTGGGGGTGGCTCTTAATTAAGAGCTCCTAACAT
TAAAATACCTTTTAGCGTAATATTTTTTCTTTTCATAGATTGAATTTCATAACAATCAAA
TAAATAATTAGGAATGTGTAAATGAAAATAAGTTCTCGATGAAAAATATAGTGAATGGAT
TAAATATTGCTTGTGCCTTCTAAAGAGAGGGTGCCTAGATGTTTTTAGAAATTTAAGTTT
CAAATCGTTTTGGAAATAACACTTTCTCAGATTTCGCTATTAAACTTGCTCCAAACAAAT
TTAAAATAAACCCAACAACTATTGATCTTAACAAATTAGGATAGGTAATAATTTACATTT
AATTTTTTATTTTCAACGATTTTTTTTAAAGAATTATTTTATAAAAACTAATTTTTCTCT
AATTTCTTTTAATTAAATAGCAATTTTTAAAAAAAATCTAGAATTCAGAAAATATTTTTC
CAGTTTTATTTGGAATTTAAAATATGAACTGGTTTTTTATTTAAATTATTGTTAAGATTA
AACATTTTTATCATAAAAACAATACTTTATTTTTCTAAATTGAATATTTAAAATTTATTT
TCTGTAAACAAACAAACAAAGGTTGCCCCTGGTCAAACTAGCTCATGTAAAATTGAAATT
GATTGTAATGGCTAAATTGATAATGGACCTTTGAGCAGCCCTTTCTTAGTAAATACTATG
ATAAAAACAAACTTTGATGTTTACTAAATGGCAATTCCTTGCAGTCTTTCAGTTTTAATC
GTACCTGGAGCTCCTCTTTAAATCTAATAATATGGAGAATTCTCCTCTAGAATGGTCAAA
AAAGCTGATAAGATTCCCATGATTATTGATAGAGATGCAGTAATATTTTTTACATAAAAC
TCAAATTTATTAAATATATTATTGAAAAAAAAATTAAATAGCTTGTAAAGAAAATGGCCA
ACAATAATATCTATTTTGTAAATTCTCAAACTAATCCTTAGGGAATTGGTAATTTTATTA
ATAGACTGTTACAGATAATCAATTTATTTATTTATTTAAAAAACTAAGAAATGATAAACT
TCTCATGTAAGTTAGCTAACGAAATGCCACTTTTATTAGATGTAATTATAGATAAGATAA
ATGGAGCACTTAATATTTAATATCACGCTCCTCACGACACTATTTTACCTCTTTTCTATT
AAGCTATTATGTTCGTCTTAAAGTTCTGA