Identifiers and Description

Gene Model Identifier

TTHERM_00219370

Standard Name

APB1 (beta subunit of adaptor protein complex 1 (AP-1))

Aliases

PreTt22365 | 18.m00391 | 3701.m00150

Description

adaptin protein, AP-1 beta subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF09090 ) MIF4G like
  • ( PF02985 ) HEAT repeat
  • ( PF01602 ) Adaptin N terminal region
  • ( PF02883 ) Adaptin C-terminal domain
  • ( PF06513 ) Repeat of unknown function (DUF1103)
  • ( PF03112 ) Uncharacterized protein family (ORF7) DUF
  • ( TIGR01889 ) staphylococcal accessory regulator family
  • ( PF09066 ) Beta2-adaptin appendage, C-terminal sub-domain
  • ( TIGR00129 ) formate dehydrogenase family accessory protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00219370

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_348040
Tetrahymena borealisEI9_06715.19.997093137033517e-262adaptin N-terminal region fami
ly protein (976 aa)
OxytrichaContig10327.0.1.g1142.000147820282363e-173hypothetical protein
WormBaseWBGene000001606.997785648757479e-148locus:apb-1 status:Partially
_confirmed UniProt:Q7YZG8
protein_id:CCD72408.1
SGDYKL135C1.9993628512956726e-92APL2 Beta-adaptin, large subun
it of the clathrin-associated
protein (AP-1) complex; binds
clathrin; involved in clathrin
-dependent Golgi protein sorti
ng
DictyBaseDDB_G02833194.997860539111522e-53ap4b1 on chromosome: 4 positio
n 525048 to 527810

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00219370(coding)
ATGGCGCAATATTTCTAATCATCAAACAAAAGAGGAGAATTATTCGAATTGACAGAAGAT
TTAAACTCTAATTCCTATGAAAAAAAGAAAGAGGCTGTCAAGAAGGTTATAGCCCATATG
ACTATCGGAAAAGATGTTTCCCCTCTCTTTTAGCCAGTTATTAAATGCTTAGAATTCCCC
TAATTAGAATTGAAGAAGCTCGTATATTTATACATCATTAACTACTCTAAAACAAAGCCT
GACGATGCCATTATGGTTGTGAGTTAATTTGATAAGGATATTAAAAATAAGCAAAATCCT
ATTCTTAGAGCTCTTGCAGTGCGTACCATGGGTTGTGTAAGAGTACCAAGCATCAACTAA
TATTTAGCTGAACCTTTAAAAGAAGCTCTTGTAGATCCCGAGCCTTATGTTCGTATGACT
GCAGCACTTTGCATTCCCAAAGTTTATGAGGTTTCACCTGACATTATTGAAAATCATAAT
CTTATTTAATCCTTGTAAAATATGCTTACAAATGAAGCAAATGCAAAAGTTTTAGCTAAT
GTTCTTATAGCTTTAAACGAAATGTCATATTACAGAGGAAAGAATTTAATAACAATCACA
TAAAAAGTATTACAAAAAATGCTAACAGCTGTCAATGAATGTCATGAATGGGGTCAAGTT
GTTGTTATGGACTACTTAGTTAACTACATTCCAGAGAACTCTAAAGAAGCTGAAATGATC
GTTGAAAGAGTTCTTCCTAGATTGTCTCTTATTAATCCTGCTGTAGTATTTAGTGCAATT
AAAGTAGTAATCAAGTTTATGGATTATATTACATCAGTTGACATTGTTAAAAACTTGAGT
GCTAAAATATCTCAAAATTTAATTTCTTTAATATCATGGCAATAACCTTAAATTTAATAC
GTTGTTTTAAAATGTGTTCCTCATATTCTTCAAAAGAGACCTGGAATTATGGAAAAGAAC
ATCAAGGTCTTCTTTTGCAATATTAATGAGCCATATTATATTAAGAATGAGAAGCTTGAC
ATCTTAGCAAAAATTTGTGATAATAAGAACTACGAATCAGTGTTAAATGAAATCAAAGAA
TACGTTAATGAACCAGATCCAGATTTCGTTAGACGTTCTATTAGCTCTTTAAGCACTATA
GCAATTAAATTCGAAAGAGCAGTTGATAAGACAATTGAAATTTTAGTAGAATAAATGAAA
TAAATTAGAGAAACTTACAGAACCACTGAACCTTATGTTTAGGAAATTATTATTGCAATG
TAAAAAATATATAGAAAATATCCAAGTAAAATTAAGCATGAAAAAAGCTTGGAAGTTCTA
ATTAATATTGTTGATTTGGCCACCGAAGAACAAGCTAAAGCAGCTGCATCTTGGATTATC
GGTGAATATGCTGAGTTCATTCCTAAAGTTGTTGAGCTTATAAATACCAGAATTTCAGAA
TTTTTACAAGAACAAAGAGGTGTTTAGTTAGAAATTTTAACAGCTGCTATTAAGATTTTA
TTGAAGTACCCTGATGAAGGATAACACTTCATCTAAAATCTTCTTGAATAAGCTTCATAT
AAGACTGAAAACCCTGATGTCCGTGATAGAGCTTTTATTTACTGGAGAATGTTGTCAATT
GATACTGAAAAAGTTAAGGACACTGTTATTTGCAAAATGCCCTCTATCCAAGAAGACAAT
TATTCAAATGATACTGAATTTACAGACAAAATGATTGACAGTTTGGGTTTAATTTGTGCT
GTTTACAGTAAGACTGTTGATGAAATGTTCCCTCGTCGTAGAAGAGTACCAACTAAAGAT
GCTAACGCTTCTCAAAACCAAAAGTCTCCTGAAAAATCTAAGATAGAAGATAAAAAGGAT
GATTCTAAAGTTGAAAAAGCTGATGTAGTAGTTGAAGATAAAAAAGAAAAGGTTACTTAA
CCATAAACTTAGGTTGTAAATCCTCCTGCTCCCGTTCAACAACCTCAACCTGCTAACTTA
AATCTTTTAGAATTATTGGATGATGCTCCAACTCCAGTATAGCCTGTTACCGTTCAAAAG
TAACCTGAAGTTAAACCAGCTAACAATGTTGGAACTGATTTACTAGATATGCTTGATGAC
CACGTTGTTCCTGCATATTAGCCAACTTAAGCTGTAAGCAACTAACCTGTTGTATAAAAT
AACAATGACTTTGACTTATTTGATTCTCCCTCCAAACCCCAAGTCGCTCCCATATAATCC
TAAATAAACTACATTAATGTAATTAATAGTACAACCCCAGGAAAAACTGGTAAATCTGGA
TTACAGCTTGATGCTTGCCTTGTTTATGAAAATAATTAAATTGTTTTGAAGCTTAGAATT
AATAACAGATCTACTTTATTAATTAACGAATTTCTCTTATAAATTTCTCCTAATTACTTT
GGTTTGAAAATAAACGAATAACCTGTAGTCAACATTTACTAAAATGCAACTGTTGAAGTT
CAAACCACTCTCTCATTCACAGGCAAATAGGATCCAACTAAATTACCTCCTAATCCTTAT
TAATTAATGATGGCTGTAAGAAATCAAATTGATACTTTCTTCTTTGATCTCCCTGCTAAC
ATAGTGCATTTGTTGAGTCTTGATGGAAGAGTAACCCAAGATGATTTTAAAACTATATGG
AAATCTATACCTGATACTACACATAGAGAGCAAAGTGTAGCTTTTATTTAGCCCCAATAT
TTCTAGATAGAATCACTTAAATAGAAGCTTAATGATAATAGAATTTTCTACATTGCAGCT
AAAAATAAAAATAGTTATTATAGTGCTAAAATAAATAATACTGTTGTCTTATTGGAAGTT
ATAGTTCCAAGTAATACTAATCCTCAAGGAGCTACTGTTGGAGCACGTAGTTAAGATTAA
AACGTCTTGTAACCACTTATTAATGGAGTACTTGAAATTCTCTAAAAATGA


>TTHERM_00219370(protein)
MAQYFQSSNKRGELFELTEDLNSNSYEKKKEAVKKVIAHMTIGKDVSPLFQPVIKCLEFP
QLELKKLVYLYIINYSKTKPDDAIMVVSQFDKDIKNKQNPILRALAVRTMGCVRVPSINQ
YLAEPLKEALVDPEPYVRMTAALCIPKVYEVSPDIIENHNLIQSLQNMLTNEANAKVLAN
VLIALNEMSYYRGKNLITITQKVLQKMLTAVNECHEWGQVVVMDYLVNYIPENSKEAEMI
VERVLPRLSLINPAVVFSAIKVVIKFMDYITSVDIVKNLSAKISQNLISLISWQQPQIQY
VVLKCVPHILQKRPGIMEKNIKVFFCNINEPYYIKNEKLDILAKICDNKNYESVLNEIKE
YVNEPDPDFVRRSISSLSTIAIKFERAVDKTIEILVEQMKQIRETYRTTEPYVQEIIIAM
QKIYRKYPSKIKHEKSLEVLINIVDLATEEQAKAAASWIIGEYAEFIPKVVELINTRISE
FLQEQRGVQLEILTAAIKILLKYPDEGQHFIQNLLEQASYKTENPDVRDRAFIYWRMLSI
DTEKVKDTVICKMPSIQEDNYSNDTEFTDKMIDSLGLICAVYSKTVDEMFPRRRRVPTKD
ANASQNQKSPEKSKIEDKKDDSKVEKADVVVEDKKEKVTQPQTQVVNPPAPVQQPQPANL
NLLELLDDAPTPVQPVTVQKQPEVKPANNVGTDLLDMLDDHVVPAYQPTQAVSNQPVVQN
NNDFDLFDSPSKPQVAPIQSQINYINVINSTTPGKTGKSGLQLDACLVYENNQIVLKLRI
NNRSTLLINEFLLQISPNYFGLKINEQPVVNIYQNATVEVQTTLSFTGKQDPTKLPPNPY
QLMMAVRNQIDTFFFDLPANIVHLLSLDGRVTQDDFKTIWKSIPDTTHREQSVAFIQPQY
FQIESLKQKLNDNRIFYIAAKNKNSYYSAKINNTVVLLEVIVPSNTNPQGATVGARSQDQ
NVLQPLINGVLEILQK


>TTHERM_00219370(gene)
ATGGCGCAATATTTCTAATCATCAAACAAAAGAGGAGAATTATTCGAATTGACAGAAGAT
TTAAACTCTAATTCCTATGAAAAAAAGAAAGAGGCTGTCAAGAAGGTTATAGCCCATATG
ACTATCGGAAAAGATGTTTCCCCTCTCTTTTAGCCAGTTATTAAATGCTTAGAATTCCCC
TAATTAGAATTGAAGAAGCTCGTATATTTATACATCATTAACTACTCTAAAACAAAGCCT
GACGATGCCATTATGGTTGTGAGTTAATTTGATAAGGATATTAAAAATAAGCAAAATCCT
ATTCTTAGAGCTCTTGCAGTGCGTACCATGGGTTGTGTAAGAGTACCAAGCATCAACTAA
TATTTAGCTGAACCTTTAAAAGAAGCTCTTGTAGATCCCGAGCCTTATGTTCGTATGACT
GCAGCACTTTGCATTCCCAAAGTTTATGAGGTTTCACCTGACATTATTGAAAATCATAAT
CTTATTTAATCCTTGTAAAATATGCTTACAAATGAAGCAAATGCAAAAGTTTTAGCTAAT
GTTCTTATAGCTTTAAACGAAATGTCATATTACAGGTAATTGTTTCTTTATTTTAATAGC
TACAAAGAGTTTTTTTCTTTTTTGAAAAAGCACAGACATAAAAATTTATAAATTTAAAAT
AAACTATCAAAAGGATTTATTAATATATCTAAAGAAAAACGTTCTTCTTTTAAATAAATA
ATTCATGCAAGAAAAATAAATAATAAGATAGATAGATAGAAATATATATAGATATGCGAA
ACATACATCTAAAAATTTAAAATAAAATTTAAATTATCACTTTTTAAAAATATAATAAAA
ATGTATTTAAACTTAAATCTTCTAGCTACTAATTATTGATAATATAAACTAACTTATTTT
TTTAAAATTAGAGGAAAGAATTTAATAACAATCACATAAAAAGTATTACAAAAAATGCTA
ACAGCTGTCAATGAATGTCATGGTAAATAGATATTTTTATGAGCTTCCTTCATTACATAT
TAAATATTTAGATTTGCTTATTAGTTATTTCGAAATATTAATTTTATGATGTCTTAAATA
AAAGAATGGGGTCAAGTTGTTGTTATGGACTACTTAGTTAACTACATTCCAGAGAACTCT
AAAGAAGCTGAAATGTAAAATACATTTTTTATATACTAAAATTATATATCTGTTAAAAAT
CTCATAGGATCGTTGAAAGAGTTCTTCCTAGATTGTCTCTTATTAATCCTGCTGTAGTAT
TTAGTGCAATTAAAGTAGTAATCAAGTTTATGGATTATATTACATCAGTTGACATTGTTA
AAAACTTGAGTGCTAAAATATCTCAAAATTTAAGTAATCTTTTTTATTATTAATAATCTG
AAATGTGTTTTATAATTTTCATCTATTAATATTATAAAGTTTCTTTAATATCATGGCAAT
AACCTTAAATTTAATACGTTGTTTTAAAATGTGTTCCTCATATTCTTCAAAAGAGACCTG
GAATTATGGAAAAGAACATCAAGGTCTTCTTTTGCAATATTAATGAGCCATATTATATTA
AGAATGAGAAGCTTGACATCTTAGCAAAAATTTGTGATAATAAGAACTACGAATCAGTGT
TAAATGAAATCAAAGAATACGTTAATGAACCAGATCCAGATTTCGTTAGACGTTCTATTA
GCTCTTTAAGCACTATAGCAATTAAATTCGAAAGAGCAGTTGATAAGTATGAATTTCATT
TATTTAACCTATTCATGATTGGAATATTTTTAACAATAAACAAAAAATAGGACAATTGAA
ATTTTAGTAGAATAAATGAAATAAATTAGAGAAACTTACAGAACCACTGAACCTTATGTT
TAGGAAATTATTATTGCAATGTAAAAAATATATAGAAAATATCCAAGTAAAATTAAGCAT
GAAAAAAGCTTGGAAGTTCTAATTAATATTGTTGATTTGGCCACCGAAGAACAAGCTAAA
GCAGCTGCATCTTGGATTATCGGTGAATATGCTGAGTTCATTCCTAAAGTTGTTGAGCTT
ATAAATACCAGAATTTCAGAGTAACTAACAATAAATAATTAGCATTTTGATCAATTTTTA
CAATAATATTTTCAATTAAATAAGATTTTTACAAGAACAAAGAGGTGTTTAGTTAGAAAT
TTTAACAGCTGCTATTAAGATTTTATTGAAGTACCCTGATGAAGGATAACACTTCATCTA
AAATCTTCTTGAATAAGCTTCATATAAGACTGAAAACCCTGATGTCCGTGATAGGTAATA
AAAAAATTCCAAAGAAAATGATAAAAATCCTTAATTTTAAATTAAATTTTAGAGCTTTTA
TTTACTGGAGAATGTTGTCAATTGATACTGAAAAAGTTAAGGACACTGTTATTTGCAAAA
TGCCCTCTATCCAAGAAGACAATTATTCAAATGATACTGAATTTACAGACAAAATGATTG
ACAGTTTGGGTTTAATTTGTGCTGTTTACAGTAAGACTGTTGATGAAATGTTCCCTCGTC
GTAGAAGGTGATTAAAATTTATCAAATCTAATTAATATATATTTAAAAGTTAAAATTAAA
ATAAAGAGTACCAACTAAAGATGCTAACGCTTCTCAAAACCAAAAGTCTCCTGAAAAATC
TAAGATAGAAGATAAAAAGGATGATTCTAAAGTTGAAAAAGCTGATGTAGTAGTTGAAGA
TAAAAAAGAAAAGGTTACTTAACCATAAACTTAGGTTGTAAATCCTCCTGCTCCCGTTCA
ACAACCTCAACCTGCTAACTTAAATCTTTTAGAATTATTGGATGATGCTCCAACTCCAGT
ATAGCCTGTTACCGTTCAAAAGTAACCTGAAGTTAAACCAGCTAACAATGTTGGAACTGA
TTTACTAGATATGCTTGATGACCACGTTGTTCCTGCATATTAGCCAACTTAAGCTGTAAG
CAACTAACCTGTTGTATAAAATAACAATGACTTTGACTTATTTGATTCTCCCTCCAAACC
CCAAGTCGCTCCCATATAATCCTAAATAAACTACATTGTATATTTTGTTTGAGTTGCTTT
AAATTAAAATCTTATTTTAAATAAAAAAAAGAATGTAATTAATAGTACAACCCCAGGAAA
AACTGGTAAATCTGGATTACAGCTTGATGCTTGCCTTGTTTATGAAAATAATTAAATTGT
TTTGAAGCTTAGAATTAATAACAGATCTACTTTATTAATTAACGAATTTCTCTTATAAAT
TTCTCCTAATTACTTTGGTTTGAAAATAAACGAATAACCTGTAGTCAACATTTACTAAAA
TGCAACTGTTGAAGTTCAAACCACTCTCTCATTCACAGGCAAATAGGATCCAACTAAATT
ACCTCCTAATCCTTATTAATTAATGATGGCTGTAAGAAATCAAATTGATACTTTCTTCTT
TGATCTCCCTGCTAACATAGTGCATTTGTTGGTAACTAAATTTTATAAATTTTTTTAATC
AATGAATTTATTTATTTCTTGTTACTAAAAACTAACAGAGTCTTGATGGAAGAGTAACCC
AAGATGATTTTAAAACTATATGGAAATCTATACCTGATACTACACATAGAGAGCAAAGTG
TAGCTTTTATTTAGCCCCAATATTTCTAGATAGAATCACTTAAATAGAAGCTTAATGATA
ATAGAATTTTCTACATTGCAGCTAAAAATAGTAAATAAATATTAATTAAACTTAATTTTT
GTGAATTAAAATATTTATTATTTAAAAAATAGAAAATAGTTATTATAGTGCTAAAATAAA
TAATACTGTTGTCTTATTGGAAGTTATAGTTCCAAGTAATACTAATCCTCAAGGAGCTAC
TGTTGGAGCACGTAGTTAAGATTAAAACGTCTTGTAACCACTTATTAATGGAGTACTTGA
AATTCTCTAAAAATGA