Identifiers and Description

Gene Model Identifier

TTHERM_00242120

Standard Name

APAT1 (aspartyl protease acetyltransferase)

Aliases

PreTt18950 | 20.m00414 | 3706.m00178

Description

acetyltransferase, GNAT family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF08445 ) FR47-like protein
  • ( PF01657 ) Domain of unknown function
  • ( PF00026 ) Eukaryotic aspartyl protease
  • ( PF00583 ) acetyltransferase, GNAT family
  • ( TIGR03065 ) sortase B signal domain, QVPTGV
  • ( TIGR01575 ) ribosomal-protein-alanine acetyltransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00242120

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07781.18.998537725811687e-130hypothetical protein (433 aa)
DictyBaseDDB_G02794111.9991095569230066e-20ctsD on chromosome: 3 position
2104523 to 2105867
WormBaseWBGene000002170.000000000000001999258566166494locus:asp-4 status:Confirmed
UniProt:Q21966 protein_id
:CAA90633.1
OxytrichaContig20708.0.g670.000000000000008002679274403579Eukaryotic aspartyl protease
SGDYPL154C0.000000000000020000882446601127PEP4 Vacuolar aspartyl proteas
e (proteinase A), required for
the posttranslational precurs
or maturation of vacuolar prot
einases; important for protein
turnover after oxidative dama
ge; synthesized as a zymogen,
self-activates
Stentor CoeruleusSteCoe_318270.0000000007582560427911907

General Information

Paragraph NoGene NameParagraph Text
92APAT1APAT1 contains an Asp domain (E-value 3.9e-32). Proteins that contain this domains typically catalyze the transfer of acetyl groups and include pepsin-like aspartate proteases. APAT1 is likely to cut peptide bonds, take out the aspartyl group, and substitute it with an acetyl group. Paragraph by: Anna Cechony and Marzia Zendali (undergraduates), Keck Science Department, Scripps College.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00242120(coding)
ATGATTTTTTAAAATAGAAATTTTCTGCTACTTTTCTTAGGTTTTCTATCTTTATTTTCT
ATCATAAGCTCTAAAGAAGTTTAACTGATTAAGATTGATTTGGATAAAAATGAAAGAGAT
AATGAAAAAACTCTCTTATCATAAAGCTCAACTATCAATTTGTTAAATTAGGAAAATCTT
GCTTATGTTGGATTAGTATAAATTGGTACTCCTGCTTAAAATTTTTATGTTATATATGAT
ACAGGTTCTAATGATCTTTTTGTTTAATAATATGGTTGTTAAGGGTGTACAGTTACACCT
AGTTTAGGCTATACACCAAATGTCTATAAATCTTGGCTATCATCTACAAGCAGTGTTTCA
ACTAATAAAATATAGCTGAGTTATGGATCATTAACTGCATACGGATATAAAGGAAATGAA
AGTGTTTGGTTAAATGGGCACGCTGCAACTGCATTTAAAATGATATTTGTTTATCAAGAA
GGTAGTTCATAGTTTGGTAGTAAAAGTTCAGCTTTTGATGGTATAATGGGTTTGTCTAAT
GCCTAATCAAATATTAATATATTTGAATAAGGAAAATCGGAAGGAGTTTTAAATACTTCT
CTCTTTGCATTTGATTTAGCAAATAATAAATTTTACTATGATGATATCGATTAAAAATAT
CTCGATGCTCCATCAGTACCTTGTTCCATGGATGATAGATGGACATTCACAATTTTAGGC
CTTCATATTAATGGATAAGATTATACTGATAGTTTAAGCTCTTAAGATGGCTTAGTTGAC
TCAGGAACATCTTTGATTTATTTAAGCAATGGAGTTATATCTGCAATTGTAAATTCAAGT
AGTAAATTTTCAAGTAGACTTTAAGGAGCATATAGCTTAGATAATTGTGCTGGTTGCTTA
TGCTAAGAAATCAATTTTCTTCCTGTAATAGAATTTTATTCAAGAGGAGCTTTAATACTG
TTACCTCCTTCTTAGTACATGATGGTATATTCTTAATACTGTATATTGTCAATTTAAGAC
AGCTCATAATTCGGATTCAATCTTTTAGGTGATGCTTTTATGAGATAGCTAGTTGTTACA
TACAACAAATAAGATAATGAAATGACTTTCTATGGACCAAACAGCTCTTTTATGACTAAC
AAGAAAACTATACCAACTTTTATAGTTTTAACAGTATTTGCTGCATTAGGAATTTTAGCA
CTCCTTTTTGTTTCATATAGAGCTCATAAAGTTAAACAAAGTTTATATTACAATAACTCA
CCTTTAACTAGGAGATTAATTTGA


>TTHERM_00242120(protein)
MIFQNRNFLLLFLGFLSLFSIISSKEVQLIKIDLDKNERDNEKTLLSQSSTINLLNQENL
AYVGLVQIGTPAQNFYVIYDTGSNDLFVQQYGCQGCTVTPSLGYTPNVYKSWLSSTSSVS
TNKIQLSYGSLTAYGYKGNESVWLNGHAATAFKMIFVYQEGSSQFGSKSSAFDGIMGLSN
AQSNINIFEQGKSEGVLNTSLFAFDLANNKFYYDDIDQKYLDAPSVPCSMDDRWTFTILG
LHINGQDYTDSLSSQDGLVDSGTSLIYLSNGVISAIVNSSSKFSSRLQGAYSLDNCAGCL
CQEINFLPVIEFYSRGALILLPPSQYMMVYSQYCILSIQDSSQFGFNLLGDAFMRQLVVT
YNKQDNEMTFYGPNSSFMTNKKTIPTFIVLTVFAALGILALLFVSYRAHKVKQSLYYNNS
PLTRRLI


>TTHERM_00242120(gene)
ATGATTTTTTAAAATAGAAATTTTCTGCTACTTTTCTTAGGTTTTCTATCTTTATTTTCT
ATCATAAGTAAACTCTTTGCTATTATATTTTACTGCGCAAAATTCATTATAAATTATCAG
CAATTCCAATTATCATATTAAAATAGGCTCTAAAGAAGTTTAACTGATTAAGATTGATTT
GGATAAAAATGAAAGAGATAATGAAAAAACTCTCTTATCATAAAGCTCAACTATCAATTT
GTTAAATTAGGAAAATGTAATATAACTATTATAAATTTATAATGTATTAAATTTAAATTT
GAAATTTATTTACAGCTTGCTTATGTTGGATTAGTATAAATTGGTACTCCTGCTTAAAAT
TTTTATGTTATATATGATACAGGTTCTAATGTAATTATTTATTTACTTCAAATCTTTAAA
AATATACTCATTATTATAATAAATATAAGGATCTTTTTGTTTAATAATATGGTTGTTAAG
GGTGTACAGTTACACCTAGTTTAGGCTATACACCAAATGTCTATAAATCTTGGCTATCAT
CTACAAGCAGTGTTTCAACTAATAAAATATAGCTGAGTGTAATAAATCTTTTATTTTTAA
AGAATTTAACTAACTACAACTAAAAAATAAATAGTATGGATCATTAACTGCATACGGATA
TAAAGGAAATGAAAGTGTTTGGTTAAATGGGCACGCTGCAACTGCATTTAAAATGATATT
TGTTTATCAAGAAGGTAGTTCATAGTTTGGTAGTAAAAGTGTAATGAATTTACAATTTAA
TTTTGTTAGAAATTAAATTAGAATAACTAAAATGAAATTTAATTTTTTTTTTTTCCAAAC
AGTCAGCTTTTGATGGTATAATGGGTTTGTCTAATGCCTAATCAAATATTAATATATTTG
AATAAGGAAAATCGGAAGGAGTTTTAAATGTAATTTTTTACTTTACAATAGACTAAATAA
ATTGAAATATATTTCATAATTCAAAGACTTCTCTCTTTGCATTTGATTTAGCAAATAATA
AATTTTACTATGATGATATCGATTAAAAATATCTCGATGCTCCATCAGTACCTTGTTCCA
TGGATGATAGATGGGTAAATTTTTAATTTCTTGAGAAATTATAACAATTTTGATTTTATA
ATTTCTAATAGACATTCACAATTTTAGGCCTTCATATTAATGGATAAGATTATACTGATA
GTTTAAGCTCTTAAGATGGCTTAGTTGACTCAGGAACATCTTTGATTTATTTAAGCAATG
GTATTGAAATATAAACTAATAATATAATTAAATACTTTTACTATGACATTTTTTTTTAAA
AAACTATATCATTTTAAAAATATTATATTTTAATAAAACTAAAAGGAGTTATATCTGCAA
TTGTAAATTCAAGTAGTAAATTTTCAAGTAGACTTTAAGGAGCATATAGCTTAGATAATT
GTGCTGGTTGCTTATGCTAAGAAATCAATTTTCTTCCTGTAATAGAATTTTATTCAAGAG
GAGCTTTAATACTGTTACCTCCTTCTTAGTACATGATGGTATATTCTTAATACTGTATAT
TGTCAATTTAAGACAGCTCATAATTCGGATTCAATCTTTTAGGTGATGCTTTTATGAGAT
AGCTAGTTGTTACATACAACAAATAAGATAATGAAATGACTTTCTATGGGTATATTTTAA
ATAAATATAATTAATAGTATGTTTTATCAATTTAAATTTTAACTTAATAGACCAAACAGC
TCTTTTATGACTAACAAGAAAACTATACCAACTTTTATAGTTTTAACAGTATTTGCTGCA
TTAGGAATTTTAGCACTCCTTTTTGTTTCATATAGAGCTCATAAAGTTAAACAAAGTTTA
TATTACAATAACTCACCTTTAACTAGGAGATTAATTTGA