Identifiers and Description

Gene Model Identifier

TTHERM_00896070

Standard Name

APA2 (alpha subunit of adaptor protein 2 (AP-2) complex)

Aliases

PreTt21978 | 159.m00086

Description

Adaptin protein, AP-2 alpha subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF02985 ) HEAT repeat
  • ( PF01602 ) Adaptin N terminal region
  • ( PF02883 ) Adaptin C-terminal domain
  • ( PF02421 ) ferrous iron transport protein B
  • ( PF00806 ) Pumilio-family RNA binding repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00896070

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06549.19.997093137033517e-262adaptin N-terminal region fami
ly protein (959 aa)
OxytrichaContig20345.0.g932.0005951135209932e-158Adaptin N terminal region
DictyBaseDDB_G02734395.9988791724737674e-136ap2a1-1 on chromosome: 2 posit
ion 3000942 to 3004624
WormBaseWBGene000001612.000319284850678e-127locus:apa-2 status:Confirmed
UniProt:Q22601 protein_id
:CCD68583.1
Stentor CoeruleusSteCoe_36718.074506789675094e-73
SGDYBL037W7.001220308967917e-48APL3 Alpha-adaptin, large subu
nit of the clathrin associated
protein complex (AP-2); invol
ved in vesicle mediated transp
ort

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00896070(coding)
ATGTCTCAAGAATCAATGAATGGACTGCTTTAGTTCATTAAGGACATTAGGCAGTGTAAA
AATAAAGAATAAGAGTATAGCAGAGTTGCAAAAGAATTAGCAAAGATTAGAAATAAGTTT
GAAAATAAAGGTATATCAGGCTATTAGCGCAAGAAGTATGTTTGGAAAATGCTTTACATA
TACATTCTAGGTTATGAAATTGATTTCGGTCATTTCCAAGCAGCAAATTTGATCAATTCC
TCGAAATTTTCTGAAAAGTACACTGGCTATATAGCGACTGGCATTTTGGTAAACGAAAAT
AACTCAGAAATTTACAAAACAATAGCATAATCAATTAAGTAAGACATTTAGAGTATGAAT
GAAATTAATCAATCCTTAGCTATTTCTATGATAGGCTCTCTTGCTCCTAAGGAACTTACT
GAGTAGCTTGATTAAGAAATTATTAGAATAGTACTTGGAGAGAGAAATTGCTAGCCTTAA
GTTCGTAAAAAAGCAATCCTCTGTTTATTAAGAATGTATAGAAAGTATAATGAAAGATAT
GATCCAACTAAATGGGTTTCACAAACAATCAAGATGTTTGAAGGAAGGTATTTCAGCTTA
GGTTTTTTGAGCGCCTCAGCTTCATTCCTTCTAGGTGTTGCATAGCTCTCCTCTCCTGAA
TTGTTTTCAGATGTAGTCCCAAAAATTGTAAAGATTCTCTCTAAATTAGTTTTAAACAAA
GAGTGCTCTAACGATTACTTATATTATCAAACACCTAATCCTTGGTTGTAAGTTAAACTC
TTGAAGATTTTGCAACTCTACCCTATTCCAACAGATGAAAATGTAAAGAAAGTCTTATTA
GAAGTATTAAGAACTTTAATTAACATTGATGTCACCAAGAGTGTGAATCGTAATAATGTA
AACCACGGTATTCTCTTTGAAGCCACTTCACTCTTAATTCATTATGGAGACGGTATTCCT
AAAAAGCGTATGGATGAAGTCATTAAAAGATTGGGTGTCTTCATTTCATTCAGAGAACCT
AACTTTAAATATTTAGGTTTAGAAACTATGTGCAAGCTTGTTCACAATAATGAAGATTTG
ATTGAGAAGCATTTAAGTACAATTTTAAAGTCTTTAAAATCAAATGATATTTCAATTAAG
AGAAGAGCATTAGAATTGCTTTATTTAATGTGCAATCAAAACACCTCCAAAAGAATAGTA
GAAGAATTGTTGGGATATGCTGAAGAAAAAGCTGATTTAGTTATTAAGGAAGAATTAGTC
TTGAAAATAGCTATTTTAGCTGAAAAATTCGCTGATAATTTAACTTGGTACATCGATTGC
GTTATAAAATTGATTTCATCTTCAGGTGATTTTGTCACTGATGACATCTGGTTCCGTATT
ATTTAAATGATAGTCGGTTTTGGTAAAGAATCCAATCCAGAATTGCAACGTTATGCTGCT
CTTAAGTTATTCACTTCCATCAACATCCCTCATGCTCATGAAAATCTAGTTTGCATTGCT
GCTTTCGTCATATCTGAATACTCTCCTCTTCTCGTAGATTCTGGCAAAGACCCTCAAAAG
ATATTTGATGTTCTTAATCGTCATTACAGTTTATGTTCAGAAAAAGGAAGATAGATGCTT
TTGAACGCATATGCAAAATTAGCAGCAAGATATAGCGATTTAAGAGGTATTGTTTAATCA
ATATTTGAAGTTTCAAGTGAACACTTCGATCCTGATTTACAATAAAGAGGTGTTGAATAT
AATGCTCTTTTAAATGAGCCTTAATAGGTTTAGCAAATTATCTTTAGTAAATAGCCACCT
TTCTCTTTGGATATTTAGGGCGACAATCCTTTGATTAAGAGAATTTATAAGCTCAAGATG
GGTTCTAAATAAGAAATGAAAGATCCCACAGTCGCATTAGAAAATCAGAGAAGAGCTTAA
GAAAGTGTAGAATTCTTGACAAAATCTGCAGTTGGGGTACAAGCACTTAGCAATACCCCA
TAAGCTAAGATCCCATTAAGCAATCATATTGAAAACTTAAAAAACAATGTTCTATACGAA
ATTAACTAGAATTCTGTTGTTGTATCAGGAAGTAATATTATTTCCCCTCCTCCAAATATG
AACTCTCTCAGCAACATTAATTAAATCAAAAATTTACTTTCTTCCTCAATAGGCTAAGTA
TATGAATCTAATGAGCTTACTGTTTAATTCAAGAGTGATTATTAACAACATATGGGTAAA
ATTGCTATGTAATTCGAATCTAAGATTGGAAGAATGGAAAATGTTAGTTTTGTTATTGCA
AACTCAGATTAGAATGGACTAGATTTTAACATCTCTCCTATTAAGTATGATGAACATCCT
TAAATTATGATGCAAGTTATGTCTACTGATCCTCGCTAATAAATGCCTATTGGTTTATTA
GCTTATGATGTTAATGGATAAAATAAAAGAATAGAAATCCCTCTTCCTATTTTTACTAAT
AAGTTTATTTAAAGAGTTGATATGCCTTAAGATGCATTTGATAAATTCTGGATTGAATAT
TCTTCTGGCAGTAACAGTACTTCACACAAATTAGATGCTTATATTCCTAATCCTGCATAA
ATTAATGTCTCAATCAATGATATTCTTAAAAGAGCAGGTGGGCTTTTAAATAATGTCTTG
GGTCTTAAAGTTATGGCTATCCCTGACATGAACAATATTAACGTATTATACGGTGTAGGA
TAGTTTACTTACAAAGATGTTGAAAAGAATGCAGTTAAAAACTTACCAGTTATGATTTAA
ATGGAAGGATCTGAGGTTTATAAAGAGCACCTCAGATTATCTCTCCGTGGAGCTGGTCAT
GGTTTCCCTATTGCTAATCTCTATCAAATTATTGTAAGTTTTATGGGTGTCGATTGA


>TTHERM_00896070(protein)
MSQESMNGLLQFIKDIRQCKNKEQEYSRVAKELAKIRNKFENKGISGYQRKKYVWKMLYI
YILGYEIDFGHFQAANLINSSKFSEKYTGYIATGILVNENNSEIYKTIAQSIKQDIQSMN
EINQSLAISMIGSLAPKELTEQLDQEIIRIVLGERNCQPQVRKKAILCLLRMYRKYNERY
DPTKWVSQTIKMFEGRYFSLGFLSASASFLLGVAQLSSPELFSDVVPKIVKILSKLVLNK
ECSNDYLYYQTPNPWLQVKLLKILQLYPIPTDENVKKVLLEVLRTLINIDVTKSVNRNNV
NHGILFEATSLLIHYGDGIPKKRMDEVIKRLGVFISFREPNFKYLGLETMCKLVHNNEDL
IEKHLSTILKSLKSNDISIKRRALELLYLMCNQNTSKRIVEELLGYAEEKADLVIKEELV
LKIAILAEKFADNLTWYIDCVIKLISSSGDFVTDDIWFRIIQMIVGFGKESNPELQRYAA
LKLFTSINIPHAHENLVCIAAFVISEYSPLLVDSGKDPQKIFDVLNRHYSLCSEKGRQML
LNAYAKLAARYSDLRGIVQSIFEVSSEHFDPDLQQRGVEYNALLNEPQQVQQIIFSKQPP
FSLDIQGDNPLIKRIYKLKMGSKQEMKDPTVALENQRRAQESVEFLTKSAVGVQALSNTP
QAKIPLSNHIENLKNNVLYEINQNSVVVSGSNIISPPPNMNSLSNINQIKNLLSSSIGQV
YESNELTVQFKSDYQQHMGKIAMQFESKIGRMENVSFVIANSDQNGLDFNISPIKYDEHP
QIMMQVMSTDPRQQMPIGLLAYDVNGQNKRIEIPLPIFTNKFIQRVDMPQDAFDKFWIEY
SSGSNSTSHKLDAYIPNPAQINVSINDILKRAGGLLNNVLGLKVMAIPDMNNINVLYGVG
QFTYKDVEKNAVKNLPVMIQMEGSEVYKEHLRLSLRGAGHGFPIANLYQIIVSFMGVD


>TTHERM_00896070(gene)
ATGTCTCAAGAATCAATGAATGGACTGCTTTAGTTCATTAAGGACATTAGGCAGTGTAAA
AATAAAGAATAAGAGTATAGCAGAGTTGCAAAAGAATTAGCAAAGATTAGAAATAAGTTT
GAAAATAAAGGTATATCAGGCTATTAGCGCAAGAAGTATGTTTGGAAAATGCTTTACATA
TACATTCTAGGTTATGAAATTGATTTCGGTCATTTCCAAGCAGCAAATTTGATCAATTCC
TCGAAATTTTCTGAAAAGTACACTGGCTATATAGCGACTGGTAACATATTGAATTATAAT
ATTGTCTGATTCGAAAGAATGATTTTAATTTTTGAAATCCTCATCTTGCATTTTATTCAC
ATGACTAAAATATTAAAAATAGGCATTTTGGTAAACGAAAATAACTCAGAAATTTACAAA
ACAATAGCATAATCAATTAAGTAAGACATTTAGAGTATGAATGAAATTAATCAATCCTTA
GCTATTTCTATGATAGGCTCTCTTGCTCCTAAGGAACTTACTGAGTAGCTTGATTAAGAA
ATTATTAGAATAGTACTTGGAGAGAGAAATTGCTAGCCTTAAGTTCGTAAAAAAGCAATC
CTCTGTTTATTAAGAATGTATAGAAAGTATAATGAAAGATATGATCCAACTAAATGGGTT
TCACAAACAATCAAGATGTTTGAAGGAAGTAATTCATTCATTTATTTTATTTGCACTATT
TCAACTAAAATGACGAATAAAAAACAGACTTAAAAAAATATTAAATCAAATTATTCTTCA
ATAAAATCAATCAGATTTTTGCTCTTTCAATTTCAAATCAAGACTTATTAGATTTTAAAT
AAAAACAAATTAAATAATTGATTATTTTATTAAGATTTAATATCATTTATTTTATTGCAA
ATTTATTTATTGTCAGCACCTTTTGATTCTAATTTTAATTAATATAAAAAGGGTATTTCA
GCTTAGGTTTTTTGAGCGCCTCAGCTTCATTCCTTCTAGGTGTTGCATAGCTCTCCTCTC
CTGAATTGTTTTCAGATGTAGTCCCAAAAATTGTAAAGATTCTCTCTAAATTAGTTTTAA
ACAAAGAGTGCTCTAACGATTACTTATATTATCAAACACCTAATCCTTGGTTGTAAGTTA
AACTCTTGAAGATTTTGCAACTCTACCCTATTCCAACAGATGAAAATGTAAAGAAAGTCT
TATTAGAAGTATTAAGAACTTTAATTAACATTGATGTCACCAAGAGTGTGAATCGTAATA
ATGTAAACCACGGTATTCTCTTTGAAGCCACTTCACTCTTAATTCATTATGGAGACGGTA
TTCCTAAAAAGCGTATGGATGAAGTCATTAAAAGATTGGGTGTCTTCATTTCATTCAGAG
AACCTAACTTTAAGTAAATATAATCTTTTCAATAAAAAACGGGAGTATAATTTTTATTTA
TAAAATAGATATTTAGGTTTAGAAACTATGTGCAAGCTTGTTCACAATAATGAAGATTTG
ATTGAGAAGCATTTAAGTACAATTTTAAAGTCTTTAAAATCAAATGATATTTCAATTAAG
AGAAGAGCATTAGAATTGCTTTATTTAATGTGCAATCAAAACACCTCCAAAAGAATAGTA
GAAGAATTGTTGGGATATGCTGAAGAAAAAGCTGATTTAGTTATTAAGGAAGAATTAGTC
TTGAAAATAGCTATTTTAGCTGAAAAATTCGCTGATAATTTAACTTGGTACATCGATTGC
GTTATAAAATTGATTTCATCTTCAGGTGATTTTGTCACTGATGACATCTGGTTCCGTATT
ATTTAAATGATAGTCGGTTTTGGTAAAGAATCCAATCCAGAATTGCAACGTTATGCTGCT
CTTAAGTTATTCACTTCCATCAACATCCCTCATGCTCATGAAAATCTAGTTTGCATTGCT
GCTTTCGTCATATCTGAATACTCTCCTCTTCTCGTAGATTCTGGCAAAGACCCTCAAAAG
ATATTTGATGTTCTTAATCGTCATTACAGTTTATGTTCAGAAAAAGGTAATTTATTATTT
ATATATAAAGAGTGCTTGATAATAAATAAATAAATAAATCAAAATCATTATAGTTATTTA
TGTATATAATTTTAGTCATTATTGTGGTTTAAATAATTTATCATTTGTATTATAGGAAGA
TAGATGCTTTTGAACGCATATGCAAAATTAGCAGCAAGATATAGCGATTTAAGAGGTATT
GTTTAATCAATATTTGAAGTTTCAAGTGAACACTTCGATCCTGATTTACAATAAAGAGGT
GTTGAATATAATGCTCTTTTAAATGAGCCTTAATAGGTTTAGCAAATTATCTTTAGTAAA
TAGCCACCTTTCTCTTTGGATATTTAGGGCGACAATCCTTTGATTAAGAGAATTTATAAG
CTCAAGATGGGTTCTAAATAAGAAATGAAAGATCCCACAGTCGCATTAGAAAATCAGAGA
AGAGCTTAAGAAAGTGTAGAATTCTTGACAAAATCTGCAGTTGGGGTACAAGCACTTAGC
AATACCCCATAAGCTAAGATCCCATTAAGCAATCATATTGAAAACTTAAAAAACAATGTT
CTATACGAAATTAACTAGAATTCTGTTGTTGTATCAGGAAGTAATATTATTTCCCCTCCT
CCAAATATGAACTCTCTCAGCAACATTAATTAAATCAAAAATTTACTTTCTTCCTCAATA
GGCTAAGTATATGAATCTAATGAGCTTACTGTTTAATTCAAGAGTGATTATTAACAACAT
ATGGGTAAAATTGCTATGTAATTCGAATCTAAGGTATTAATTGTTAATTTTTACTCCTTT
TAAATAATAAATTTAAGTTAATTAAATTTGAAAGTATATTTGGAAGTCAAACAAACTACC
TTCAATTAATATTCAATTTTTTCAATTTCATTTAAATATTAATCTGATTGAGTTATTGGG
TGGTTTAGTTTAAGCTCTATTTAATAAAAAGTAGTTGAATTAATAATTGAAAAATTATAA
ATTGATTCATCAATCCTAACTAATTATCTTTGAAAATTTATTAGAATATTTTAAATAATA
TTAGTCAAAAAATAAATAAATTGATTTAAAATTAAATACATCCCTTTTATTTGTTCTAAT
AAATTGTTTTTATTAAACACAATTTAAAATTTTTATATTTTTAGAAAACATAAAAATAAG
AATTTTTTTATGCTTTCATAGTTTTTTTAAAGAAAATTTAATCTAAAAAAGAATTTTTGA
TTAAATTGAAAAAAAATTTTATTTTAATTTTAAATTAAAAGATTGGAAGAATGGAAAATG
TTAGTTTTGTTATTGCAAACTCAGATTAGAATGGACTAGATTTTAACATCTCTCCTATTA
AGTATGATGAACATCCTTAAATTATGATGCAAGTTATGTCTACTGATCCTCGCTAATAAA
TGCCTATTGGTTTATTAGCTTATGATGTTAATGGATAAAATAAAAGAATAGAAATCCCTC
TTCCTATTTTTACTAATAAGTTTATTTAAAGAGTTGATATGCCTTAAGATGCATTTGATA
AATTCTGGATTGAATATTCTTCTGGCAGTAACAGTACTTCACACAAATTAGATGCTTATA
TTCCTAATCCTGCATAAATTAATGTCTCAATCAATGATATTCTTAAAAGAGCAGGTGGGC
TTTTAAATAATGTCTTGGGTCTTAAAGTTATGGCTATCCCTGACATGAACAATATTAACG
TATTATACGGTGTAGGATAGTTTACTTACAAAGATGTTGAAAAGAATGCAGTTAAAAACT
TACCAGTTATGATTTAAATGGAAGGATCTGAGGTTTATAAAGAGCACCTCAGATTATCTC
TCCGTGGAGCTGGTCATGGTTTCCCTATTGCTAATCTCTATCAAATTATTGTAAGTTTTA
TGGGTGTCGATTGA