Identifiers and Description

Gene Model Identifier

TTHERM_00215960

Standard Name

AOS2 (Activation Of Smt3p 2 )

Aliases

PreTt22220 | 18.m00246 | 3701.m00009

Description

Subunit of heterodimeric nuclear SUMO activating enzyme E1 with Uba2p

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00899 ) ThiF family
  • ( TIGR02354 ) thiamine biosynthesis protein ThiF
  • ( TIGR02355 ) molybdopterin synthase sulfurylase MoeB
  • ( TIGR00055 ) di-trans,poly-cis-decaprenylcistransferase
  • ( TIGR02356 ) thiazole biosynthesis adenylyltransferase ThiF

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 24.6%

TetraMine Data

TTHERM_00215960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06564.19.997093137033517e-262ThiF family protein (520 aa)
DictyBaseDDB_G02879657.996627236682682e-106nae1 on chromosome: 5 position
887341 to 889297
OxytrichaContig9991.0.g101.999022616705709e-90ThiF family
WormBaseWBGene000067351.0004460510701209e-64locus:ula-1 NEDD8-activating
enzyme E1 regulatory subunit
status:Confirmed UniProt:Q
18217 protein_id:CCD65733.1
Stentor CoeruleusSteCoe_301131.1089390193121365e-40
SGDYPR180W4.9988726541653934e-26AOS1 Subunit of a heterodimeri
c nuclear SUMO activating enzy
me (E1) with Uba2p; activates
Smt3p (SUMO) before its conjug
ation to proteins (sumoylation
), which may play a role in pr
otein targeting; essential for
viability

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000186
  2. Ref:SUPR000154

Sequences

>TTHERM_00215960(coding)
ATGTCATCTAAAGATAAATACGATAGATAGCTTCGTCTTTGGGGTCCTCAAGGCTAAAGA
AAGTTGGCCAATTCTAAGATTTTGCTCTTAGGAGCAGCACCTGCAGGAGTTGAAGCTCTT
AAAAATTTAGTTTTACCAGGATGCGGTCACATTACTATTGTAGACCACCAACTCATTACT
GAGAGAGATTTAGGAAACAATTTTTTCTGCTCTCCTGAAGATTTAGGTCAACCCCGTGCT
AAGAGTGTCTGTGATAATCTTACAGAAATGAATCCTGAAGATGTTCATGGTAAGTGGCTT
AATGAAAATGTAGATGAATTAGCTGCTAAGGAAGATTTTATTAAAGAGTTTACTTGCGTT
ATAGCAAATGAGTTGCTTGATGAAGAACTTCATAAGCTATCTGTTATTTGTGATAAATAT
AATATTAAATTACTGGCAATCTAAACAAATGGATTTTATGCTTAGTTGCGTCTCTAAGCA
GGTCGTCATTGCATTATAGAAAGCAAACCAGACAGAGACTTCTATGACTGGACTCTTCGT
ATCCGCCAACCTTTCTAACATCTTCAAGATTTTTGTGATAAATTTGATTTGTAGGATTTA
TCAACTCATGAAGATAAGAATCCTCTAGCTCACGTACCTTTTGTAGTTATTTTAGTAAAG
GCTATGAATGCATGGAAGCAATCTCATAATGGTAATGCTCCTTCATCAATCCAAGAAAAG
AATGAATTTAAAAAAACCATCGAGACTCAAATGCACTGGCTTGAAGCTAAGGATCGTGAA
AATTTCGAAGAAGCTCTTGCCAAGATTTACTGGGCTCATAAAGATGCTACCTAAATTCCA
GATAATTTATAAGTTCTTTTTGATCATGATTATTGTAAAAATTTGGATCACTCTAGCTCT
GATGACTTAAAGTTCTGGACTCTTGTAGCTGCTCTTAAGAAATTCCGTGATGAAAATAAC
CACTTCCTGCCTGTTGATCGTCGTATCCCAGATATGAAATCTACTACTGAATGGTATATC
TAATTAAAGGAGGTTTATCAAACCTAACACAATGCCGACCGTGAAGCTTTTGTAAAAATT
CTAAATTAAATAAATACCAAAAATCTTGTTTTTGATCAAAATGAGGATATTTAAGTATTC
CTTGATAATATTAACTGCTTAGAATTTATCGATTTCCACTCTATTGATAACGAGTTAACC
AAGCCAATTGAAACAGAAAACTATGATAACCAAAACCACCTTTGGTTTGTTGGATAAAGA
GCTGTTAATTAATTCTATTAAAAGCATAGAAGATTCCCCAATCCTTCTGATTAAGCAGAG
TTGTCTTAAATAGCAGCTTAAATAAGAGAAACTAAATATCCTAATTATGTTGCTATTGAA
GAAGGTATTATCTAGGAATTCTGTAGATACGAAGATTCCCGTCTTCATAATATTGCTGCT
ATTATTGGTGGAGTTGCATCTCAAGAAGCTATTAAGCTTATAACTAACTAGTTTGTCCCT
TTAAATAACACTTACATTTTTAATGGTATTACTTGTGAAGGTGTCACTTTAGAATACTGA


>TTHERM_00215960(protein)
MSSKDKYDRQLRLWGPQGQRKLANSKILLLGAAPAGVEALKNLVLPGCGHITIVDHQLIT
ERDLGNNFFCSPEDLGQPRAKSVCDNLTEMNPEDVHGKWLNENVDELAAKEDFIKEFTCV
IANELLDEELHKLSVICDKYNIKLLAIQTNGFYAQLRLQAGRHCIIESKPDRDFYDWTLR
IRQPFQHLQDFCDKFDLQDLSTHEDKNPLAHVPFVVILVKAMNAWKQSHNGNAPSSIQEK
NEFKKTIETQMHWLEAKDRENFEEALAKIYWAHKDATQIPDNLQVLFDHDYCKNLDHSSS
DDLKFWTLVAALKKFRDENNHFLPVDRRIPDMKSTTEWYIQLKEVYQTQHNADREAFVKI
LNQINTKNLVFDQNEDIQVFLDNINCLEFIDFHSIDNELTKPIETENYDNQNHLWFVGQR
AVNQFYQKHRRFPNPSDQAELSQIAAQIRETKYPNYVAIEEGIIQEFCRYEDSRLHNIAA
IIGGVASQEAIKLITNQFVPLNNTYIFNGITCEGVTLEY


>TTHERM_00215960(gene)
ATGTCATCTAAAGATAAATACGATAGATAGCTTCGTCTTTGGGGTCCTCAAGGCTAAAGA
AAGTTGGCCAATTCTAAGATTTTGCTCTTAGGAGCAGCACCTGCAGGAGTTGAAGCTCTT
AAAAATTTAGTTTTACCAGGATGCGGTCACATTACTATTGTAGACCACCAACTCATTACT
GAGAGAGATTTAGGAAACAATTTTTTCTGCTCTCCTGAAGATTTAGGTCAACCCCGTGCT
AAGAGTGTCTGTGATAATCTTACAGAAATGAATCCTGAAGATGTTCATGGTAAGTGGCTT
AATGAAAATGTAGATGAATTAGCTGCTAAGGAAGATTTTATTAAAGAGTTTACTTGCGTT
ATAGCAAATGAGTTGCTTGATGAAGAACTTCATAAGCTATCTGTTATTTGTGATAAATAT
AATATTAAATTACTGGCAATCTAAACAAATGGATTTTATGCTTAGTTGCGTCTCTAAGCA
GGTCGTCATTGCATTATAGAAAGCAAACCAGACAGAGACTTCTATGACTGGACTCTTCGT
ATCCGCCAACCTTTCTAACATCTTCAAGATTTTTGTGATAAATTTGATTTGTAGGATTTA
TCAACTCATGAAGATAAGAATCCTCTAGCTCACGTACCTTTTGTAGTTATTTTAGTAAAG
GCTATGAATGCATGGAAGCAATCTCATAATGGTAATGCTCCTTCATCAATCCAAGAAAAG
AATGAATTTAAAAAAACCATCGAGACTCAAATGCACTGGCTTGAAGCTAAGGATCGTGAA
AATTTCGAAGAAGCTCTTGCCAAGATTTACTGGGCTCATAAAGATGCTACCTAAATTCCA
GATAATTTATAAGTTCTTTTTGATCATGATTATTGTAAAAATTTGGATCACTCTAGCTCT
GATGACTTAAAGTTCTGGACTCTTGTAGCTGCTCTTAAGAAATTCCGTGATGAAAATAAC
CACTTCCTGCCTGTTGATCGTCGTATCCCAGATATGAAATCTACTACTGAATGGTATATC
TAATTAAAGGAGGTTTATCAAACCTAACACAATGCCGACCGTGAAGCTTTTGTAAAAATT
CTAAATTAAATAAATACCAAAAATCTTGTTTTTGATCAAAATGAGGATATTTAAGTATTC
CTTGATAATATTAACTGCTTAGAATTTATCGATTTCCACTCTATTGATAACGAGTTAACC
AAGCCAATTGAAACAGAAAACTATGATAACCAAAACCACCTTTGGTTTGTTGGATAAAGA
GCTGTTAATTAATTCTATTAAAAGCATAGAAGATTCCCCAATCCTTCTGATTAAGCAGAG
TTGTCTTAAATAGCAGCTTAAATAAGAGAAACTAAATATCCTAATTATGTTGCTATTGAA
GAAGGTATTATCTAGGAATTCTGTAGATACGAAGATTCCCGTCTTCATAATATTGCTGCT
ATTATTGGTGGAGTTGCATCTCAAGAAGCTATTAAGCTTATAACTAACTAGTTTGTCCCT
TTAAATAACACTTACATTTTTAATGGTATTACTTGTGAAGGTGTCACTTTAGAATACTGA