Identifiers and Description

Gene Model Identifier

TTHERM_00215960

Standard Name

AOS2 (Activation Of Smt3p 2 )

Aliases

PreTt22220 | 18.m00246 | 3701.m00009

Description

ThiF family protein; Subunit of heterodimeric nuclear SUMO activating enzyme E1 with Uba2p

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00899 ) ThiF family
  • ( TIGR02354 ) thiamine biosynthesis protein ThiF
  • ( TIGR02355 ) molybdopterin synthase sulfurylase MoeB
  • ( TIGR00055 ) di-trans,poly-cis-decaprenylcistransferase
  • ( TIGR02356 ) thiazole biosynthesis adenylyltransferase ThiF

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 24.6%

TetraMine Data

TTHERM_00215960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06564.19.997093137033517e-262ThiF family protein (520 aa)
DictyBaseDDB_G02879657.996627236682682e-106nae1 on chromosome: 5 position
887341 to 889297
OxytrichaContig9991.0.g101.999022616705709e-90ThiF family
WormBaseWBGene000067351.0004460510701209e-64locus:ula-1 NEDD8-activating
enzyme E1 regulatory subunit
status:Confirmed UniProt:Q
18217 protein_id:CCD65733.1
Stentor CoeruleusSteCoe_301131.1089390193121365e-40
SGDYPR180W4.9988726541653934e-26AOS1 Subunit of a heterodimeri
c nuclear SUMO activating enzy
me (E1) with Uba2p; activates
Smt3p (SUMO) before its conjug
ation to proteins (sumoylation
), which may play a role in pr
otein targeting; essential for
viability

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000154
  2. Ref:SUPR000186

Sequences

>TTHERM_00215960(coding)
ATGTCATCTAAAGATAAATACGATAGATAGCTTCGTCTTTGGGGTCCTCAAGGCTAAAGA
AAGTTGGCCAATTCTAAGATTTTGCTCTTAGGAGCAGCACCTGCAGGAGTTGAAGCTCTT
AAAAATTTAGTTTTACCAGGATGCGGTCACATTACTATTGTAGACCACCAACTCATTACT
GAGAGAGATTTAGGAAACAATTTTTTCTGCTCTCCTGAAGATTTAGGTCAACCCCGTGCT
AAGAGTGTCTGTGATAATCTTACAGAAATGAATCCTGAAGATGTTCATGGTAAGTGGCTT
AATGAAAATGTAGATGAATTAGCTGCTAAGGAAGATTTTATTAAAGAGTTTACTTGCGTT
ATAGCAAATGAGTTGCTTGATGAAGAACTTCATAAGCTATCTGTTATTTGTGATAAATAT
AATATTAAATTACTGGCAATCTAAACAAATGGATTTTATGCTTAGTTGCGTCTCTAAGCA
GGTCGTCATTGCATTATAGAAAGCAAACCAGACAGAGACTTCTATGACTGGACTCTTCGT
ATCCGCCAACCTTTCTAACATCTTCAAGATTTTTGTGATAAATTTGATTTGTAGGATTTA
TCAACTCATGAAGATAAGAATCCTCTAGCTCACGTACCTTTTGTAGTTATTTTAGTAAAG
GCTATGAATGCATGGAAGCAATCTCATAATGGTAATGCTCCTTCATCAATCCAAGAAAAG
AATGAATTTAAAAAAACCATCGAGACTCAAATGCACTGGCTTGAAGCTAAGGATCGTGAA
AATTTCGAAGAAGCTCTTGCCAAGATTTACTGGGCTCATAAAGATGCTACCTAAATTCCA
GATAATTTATAAGTTCTTTTTGATCATGATTATTGTAAAAATTTGGATCACTCTAGCTCT
GATGACTTAAAGTTCTGGACTCTTGTAGCTGCTCTTAAGAAATTCCGTGATGAAAATAAC
CACTTCCTGCCTGTTGATCGTCGTATCCCAGATATGAAATCTACTACTGAATGGTATATC
TAATTAAAGGAGGTTTATCAAACCTAACACAATGCCGACCGTGAAGCTTTTGTAAAAATT
CTAAATTAAATAAATACCAAAAATCTTGTTTTTGATCAAAATGAGGATATTTAAGTATTC
CTTGATAATATTAACTGCTTAGAATTTATCGATTTCCACTCTATTGATAACGAGTTAACC
AAGCCAATTGAAACAGAAAACTATGATAACCAAAACCACCTTTGGTTTGTTGGATAAAGA
GCTGTTAATTAATTCTATTAAAAGCATAGAAGATTCCCCAATCCTTCTGATTAAGCAGAG
TTGTCTTAAATAGCAGCTTAAATAAGAGAAACTAAATATCCTAATTATGTTGCTATTGAA
GAAGGTATTATCTAGGAATTCTGTAGATACGAAGATTCCCGTCTTCATAATATTGCTGCT
ATTATTGGTGGAGTTGCATCTCAAGAAGCTATTAAGCTTATAACTAACTAGTTTGTCCCT
TTAAATAACACTTACATTTTTAATGGTATTACTTGTGAAGGTGTCACTTTAGAATACTGA


>TTHERM_00215960(protein)
MSSKDKYDRQLRLWGPQGQRKLANSKILLLGAAPAGVEALKNLVLPGCGHITIVDHQLIT
ERDLGNNFFCSPEDLGQPRAKSVCDNLTEMNPEDVHGKWLNENVDELAAKEDFIKEFTCV
IANELLDEELHKLSVICDKYNIKLLAIQTNGFYAQLRLQAGRHCIIESKPDRDFYDWTLR
IRQPFQHLQDFCDKFDLQDLSTHEDKNPLAHVPFVVILVKAMNAWKQSHNGNAPSSIQEK
NEFKKTIETQMHWLEAKDRENFEEALAKIYWAHKDATQIPDNLQVLFDHDYCKNLDHSSS
DDLKFWTLVAALKKFRDENNHFLPVDRRIPDMKSTTEWYIQLKEVYQTQHNADREAFVKI
LNQINTKNLVFDQNEDIQVFLDNINCLEFIDFHSIDNELTKPIETENYDNQNHLWFVGQR
AVNQFYQKHRRFPNPSDQAELSQIAAQIRETKYPNYVAIEEGIIQEFCRYEDSRLHNIAA
IIGGVASQEAIKLITNQFVPLNNTYIFNGITCEGVTLEY


>TTHERM_00215960(gene)
ATGTCATCTAAAGATAAATACGATAGATAGCTTCGTCTTTGGGGTCCTCAAGGCTAAAGA
AAGTTGGCCAATTCTAAGATTTTGCTCTTAGGAGCAGCACCTGCAGGAGTTGAAGCTCTT
AAAAATTTAGTTTTACCAGGATGCGGTCACATTACTATTGTAGACCACCAACTCATTACT
GAGAGAGATTTAGGAAACAATTTTTTCTGCTCTCCTGAAGATTTAGGTCAACCCCGTGCT
AAGAGTGTCTGTGATAATCTTACAGAAATGAATCCTGAAGATGTTCATGGTAAGTGGCTT
AATGAAAATGTAGATGAATTAGCTGCTAAGGAAGATTTTATTAAAGAGTTTACTTGCGTT
ATAGCAAATGAGTTGCTTGATGAAGAACTTCATAAGCTATCTGTTATTTGTGATAAATAT
AATATTAAATTACTGGCAATCTAAACAAATGGATTTTATGCTTAGTTGCGTCTCTAAGCA
GGTCGTCATTGCATTATAGAAAGCAAACCAGACAGAGACTTCTATGACTGGACTCTTCGT
ATCCGCCAACCTTTCTAACATCTTCAAGATTTTTGTGATAAATTTGATTTGTAGGATTTA
TCAACTCATGAAGATAAGAATCCTCTAGCTCACGTACCTTTTGTAGTTATTTTAGTAAAG
GCTATGAATGCATGGAAGCAATCTCATAATGGTAATGCTCCTTCATCAATCCAAGAAAAG
AATGAATTTAAAAAAACCATCGAGACTCAAATGCACTGGCTTGAAGCTAAGGATCGTGAA
AATTTCGAAGAAGCTCTTGCCAAGATTTACTGGGCTCATAAAGATGCTACCTAAATTCCA
GATAATTTATAAGTTCTTTTTGATCATGATTATTGTAAAAATTTGGATCACTCTAGCTCT
GATGACTTAAAGTTCTGGACTCTTGTAGCTGCTCTTAAGAAATTCCGTGATGAAAATAAC
CACTTCCTGCCTGTTGATCGTCGTATCCCAGATATGAAATCTACTACTGAATGGTATATC
TAATTAAAGGAGGTTTATCAAACCTAACACAATGCCGACCGTGAAGCTTTTGTAAAAATT
CTAAATTAAATAAATACCAAAAATCTTGTTTTTGATCAAAATGAGGATATTTAAGTATTC
CTTGATAATATTAACTGCTTAGAATTTATCGATTTCCACTCTATTGATAACGAGTTAACC
AAGCCAATTGAAACAGAAAACTATGATAACCAAAACCACCTTTGGTTTGTTGGATAAAGA
GCTGTTAATTAATTCTATTAAAAGCATAGAAGATTCCCCAATCCTTCTGATTAAGCAGAG
TTGTCTTAAATAGCAGCTTAAATAAGAGAAACTAAATATCCTAATTATGTTGCTATTGAA
GAAGGTATTATCTAGGAATTCTGTAGATACGAAGATTCCCGTCTTCATAATATTGCTGCT
ATTATTGGTGGAGTTGCATCTCAAGAAGCTATTAAGCTTATAACTAACTAGTTTGTCCCT
TTAAATAACACTTACATTTTTAATGGTATTACTTGTGAAGGTGTCACTTTAGAATACTGA