Identifiers and Description

Gene Model Identifier

TTHERM_00519760

Standard Name

AOS1 (AOS1 ortholog)

Aliases

PreTt10771 | 64.m00251 | 3723.m00104

Description

ThiF family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00899 ) ThiF family
  • ( TIGR02354 ) thiamine biosynthesis protein ThiF
  • ( TIGR02355 ) molybdopterin synthase sulfurylase MoeB
  • ( TIGR02356 ) thiazole biosynthesis adenylyltransferase ThiF
  • ( TIGR00449 ) tRNA-guanine transglycosylases, various specificities

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00519760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15424.19.997093137033517e-262ThiF family protein (373 aa)
OxytrichaContig11259.0.g511.9996410647472548e-29ThiF family
SGDYPR180W2.999534586690157e-23AOS1 Subunit of a heterodimeri
c nuclear SUMO activating enzy
me (E1) with Uba2p; activates
Smt3p (SUMO) before its conjug
ation to proteins (sumoylation
), which may play a role in pr
otein targeting; essential for
viability
DictyBaseDDB_G02796414.0009493637353324e-18sae1 on chromosome: 3 position
2354365 to 2355712
WormBaseWBGene000001420.000000004999139696582238locus:aos-1 SUMO-activating
enzyme subunit aos-1 status:
Confirmed UniProt:Q17820 p
rotein_id:CAA96591.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00519760(coding)
ATGGAAGTAGAATAAGTTTAGGAATAGTCTTAAAATTAAAAAGAAATTTCAAATGAAGAA
CTTTAAGTCTATGATAGACAAAGGTTCATAGGAGTTGAAGTATAAAAAAGATTATTAAAC
GCCAAAGTTTTTATCACTCCTGCAAATGGTGTTAACACAGAATTAGCAAAAAATTTAATT
CTTTGCGGTACAAATATATCAATTGCTGATAACGAGATTGTCAACTAGGATGATGTTGAA
ACAAATTTCCTTATTGCACCTCACGATTTAGGAAAAATAAGAGGTGAAGTTGTTAAAGCT
AAGCTATAAGATATGAATCCAATGGTTAAAATAGACCTTTATCAAACATTTGATATTAAG
TCATTTTACTAAAAATATATTCTTGAAAACAATGTTGATTGTTCTTTTACTAAAGAATTC
TTCAATTAATTCAATATAATAACTTCTTCAACTCCAATCTTTAAAGAAATGGAATTGTAT
GACGAAATAAGTCACTTTTTAAATATTCCTTATTACAACCAACTTTGCTGTGGTCTTTAT
GGTTTCTTTTATGTTTCTCTTGGCTCTCTATTCGAATTGACACAAGCTAAACCTAAGATA
TAAAAGACAAAAATTGTTTAAGGAAAACTTGTCAAAGAACCTATTTTATTTGAGTATTTC
CATAAAGTTAGCTTGAAATCAGAAAAATTAAAAAATTTCCTTGGAACAAATCCCAGAGGA
TCAAAGCCAGTATACCATGCAATTCAAATGATGAAAAGAGCAGAAGATTTAAATTTAAGA
TATGATCCTTACAATCACAGTGAGGAAAACTAAAAGGTTTTAGAATAAATAGTAGAGCTT
GCTCAAGAAAAAATTAAAAATGAGGAAGATAGAGAATTCTATACAAATTTTGCAAAATTC
TATGGAATTGAACACTGTCCAGTATACTCAGTTATTGGAAGTGTAGCAAGCCAAGAATTT
ATCAAAGTTATTGCCAAGGATAAAATGCCTGCCCTTAATTGGTTTGTATATGATAGCTAA
ATTGGATATGGTAAAATAGAAAGCTAAACTGATAAAATAGATGCAACATATGTAGATTTA
CCTGAGTTAACAAGAAAAGTTGAAGAATAGCAAGAATGA


>TTHERM_00519760(protein)
MEVEQVQEQSQNQKEISNEELQVYDRQRFIGVEVQKRLLNAKVFITPANGVNTELAKNLI
LCGTNISIADNEIVNQDDVETNFLIAPHDLGKIRGEVVKAKLQDMNPMVKIDLYQTFDIK
SFYQKYILENNVDCSFTKEFFNQFNIITSSTPIFKEMELYDEISHFLNIPYYNQLCCGLY
GFFYVSLGSLFELTQAKPKIQKTKIVQGKLVKEPILFEYFHKVSLKSEKLKNFLGTNPRG
SKPVYHAIQMMKRAEDLNLRYDPYNHSEENQKVLEQIVELAQEKIKNEEDREFYTNFAKF
YGIEHCPVYSVIGSVASQEFIKVIAKDKMPALNWFVYDSQIGYGKIESQTDKIDATYVDL
PELTRKVEEQQE


>TTHERM_00519760(gene)
ATGGAAGTAGAATAAGTTTAGGAATAGTCTTAAAATTAAAAAGAAATTTCAAATGAAGAA
CTTTAAGTCTATGATAGACAAAGGTTCATAGGAGTTGAAGTATAAAAAAGGTAATCTTTG
CAAATTATCATTTAAAAAAAGTAATTTATCTAATTTATCAAGATTATTAAACGCCAAAGT
TTTTATCACTCCTGCAAATGGTGTTAACACAGAATTAGCAAAAAATTTAATTCTTTGCGG
TACAAATATATCAATTGCTGATAACGAGATTGTCAACTAGGATGATGTTGAAACAAATTT
CCTTATTGCACCTCACGATTTAGGAAAAATAGTAATATTAAAAGAAATATCAATGCGCAA
TTTTTCTTATGAAAATTTATTTTGAAAATAGAGAGGTGAAGTTGTTAAAGCTAAGCTATA
AGATATGAATCCAATGGTTAAAATAGACCTTTATCAAACATTTGATATTAAGTCATTTTA
CTAAAAATATATTCTTGAAAACAATGTTGATTGTTCTTTTACTAAAGAATTCTTCAATTA
ATTCAATATAATAACTTCTTCAACTCCAATCTTTAAAGAAATGGTAAGTTAAATAAATAT
AAAACGAAATTTTATTTAAAAATGTTATTAATTAAATAATAAGGAATTGTATGACGAAAT
AAGTCACTTTTTAAATATTCCTTATTACAACCAACTTTGCTGTGGTCTTTATGGTTTCTT
TTATGTTTCTCTTGGCTCTCTATTCGAATTGACACAGTAATCAATTAATAAATAAATTAT
TTAATTAAATATCAAAGATATGCTTTTAAATTAAAGAAATAATATATCTTATTCTAACTT
TAAATAAATAAAAAAATAAAAGAGCTAAACCTAAGATATAAAAGACAAAAATTGTTTAAG
GAAAACTTGTCAAAGAACCTATTTTATTTGAGTATTTCCATAAAGTTAGCTTGAAATCAG
AAAAATTAAAAAATTTCCTTGGAACAAATCCCAGAGGATCAAAGCCAGTATACCATGCAA
TTCAAAGTAAATCAACTTTTCTTTAAATTATTATAATTAAATATATTGTGTCTACTTATT
TAAGTGATGAAAAGAGCAGAAGATTTAAATTTAAGATATGATCCTTACAATCACAGTGAG
GAAAACTAAAAGGTTTTAGAATAAATAGTAGAGCTTGCTCAAGAAAAAATTAAAAATGAG
GAAGATAGAGAATTCTATACAAATTTTGCAAAATTCTATGGAATTGAACACTGTCCAGTA
TACTCAGTTATTGGAAGTGTAGCAAGCCAAGAATTTATCAAAGTTATTGCCAGTAAGATT
CGTTTTATAATTTATTGAATTTGAAATATTTTTTAAAATTAATGTCTATTTTATATATAA
ATTTAAGAGGATAAAATGCCTGCCCTTAATTGGTTTGTATATGATAGCTAAATTGGATAT
GGTAAAATAGAAAGCTAAACTGATAAAATAGATGCAACATATGTAGATTTACCTGAGTTA
ACAAGAAAAGTTGAAGAATAGCAAGAATGA