Identifiers and Description

Gene Model Identifier

TTHERM_00088030

Standard Name

ALV2 (ALVeolin 2)

Aliases

PreTt16453 | 6.m00527 | 3836.m02119

Description

ALV2 alveolin 2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR00019 ) peptide chain release factor 1

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00088030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02491.19.997316819378982e-180hypothetical protein (561 aa)
OxytrichaContig9177.0.g50.0000020007268868677913GCC2 and GCC3

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23606287: El-Haddad H, Przyborski JM, Kraft LG, McFadden GI, Waller RF, Gould SB (2013) Characterization of TtALV2, an essential charged repeat motif protein of the Tetrahymena thermophila membrane skeleton. Eukaryotic cell 12(6):932-40

Sequences

>TTHERM_00088030(coding)
ATGAGTATATAATCAAGCAATTTTGGGTCTTTAAACAAAAACACACTTGATTTGTAATTT
AGGGAATATGGAAATATTGATGATGTTTTGAAATATCAGAAATCTCGAATAATATAGAGT
AGTGACATAGAGTAATAATAAGGAAGTGGAAGTAATAATGCATTAATTTTAAGTTGCCCT
ATTAGCCATGAATGTGATAGCTTAAATAATAGAATAATTATTCCAAATGCGCAGACTATT
CTGCAAGAAACTATTCAAACAGACACAGCAAATTTACTTGGATCTTTAGAAGCTGGTAAT
ATACCCTAAAAGAGTGGATTGTAGAAGAACTAAAGTGAATTTTTAGAATAAAAACTTAAT
TCTATGAAACAGAAACACAAATAATTGTAACAATAACTTTCAGAAGTATCTAAGATAGAT
TCAGTATCTAACAAGAAAAAAAATGTTGTACATTCTCAATCAACATAAGGATTTTTCAAA
GGAGGAGTGAGCACTTCAAATTTAGATATGTTCAATTTTGGTAGCTTAAAAAATCAAATA
AAATAAATGGATGTGATTTCAAATATTTTATCTAGTATCTAGTTAAAGCCAAATAATAAT
CAATAGAAAGACATTGAAGTTATAATAGAAAAGAATGATTTATATAGAATTTTGAAAATA
TTAATTGACTAATTGGTTTCTTACATTGAGAAGCTAAACTAAGTAGTATCTGAAAGAGAT
ATCATTGATATTTAGAGATAAAATGCAGAAAAATTAAATAATGAGCTCAAAGAAACAATA
AGAATTCTTGAAGAAGAGCTCAAGATTTATAAGAATTAAAGCACAGAAACTAAGATAGAG
CTTGAAAAGCAAAAAGCTCTCTACGATATCTTAGAAAAAAAATACTTAGATCTTCTCAAA
AGAAAATAAGAAGTTAAAATTATCAACAAAGAAACAGTCAAAGAAATTGTAATTGAAAAA
CCAATCGAAATACTAAAAGAAATCAACAATGTTAGAATTGTTAAGCAGAAAAAAGAAGTA
AGAAAAATAATTAGACCCTAAGCTGAGGTAAAGCATACAATAGAGAAGAAATTGCATATA
CTAGAAAGAGAAAAGATCGTCCCTTAAATACAAGTTGATAGATTTGTTGAAGTACCTAGA
TTTATCCCTAAAGAAGTATTAGTAGACAGACCAGTATATGTAGATAGACCTGTAAATCAA
TTCATAAATAATAATCGTATATAATAAAAAATCAAATAAAAAAGGTTGAAAAAATAGTTA
AAGTGCCTCAAATAGTAGAAAAAGAAAAATTAGTCGAGAGACCAGTATTTATTGAAAAAC
CAGTTGACAGATTTATAGAAAAGGAAACTTTTATTGATAGACCAGTCTATATTTAAGAAC
CTCCAGTACATATAGAAAAAGTTATAGAAGTTCCTAAGATTATAGAAAAGCAAAAAATAA
TTGATAGACCTATTTACATCAATTAACCACGTATAGAAAGAGTTATTGAAAAACCTGTAT
TCATAAATAAATATGAGCCAATAAATTCTTAGTTAGTTAATTCATATTCTACTCCAACTA
TTTCAACATAATTTAACTCACCTGCTGCTAATTATTAGAGATTTATACCTGAGTAAATTA
GTAGACAAAATAACTTTTTGTCACCTTTTAATTCTATACAGTAAACATTTTCTTAAGATT
TAACTTCACCTTCATACATTAAATAGTATGTTTGAAAAATATTTATTTGTAATTGTTAAA
TAGTATAGTTTAATAAAAATTAGTCTATTCTTAAAATTTCAAATTAGTTTATACTTAATT
ATTTCCTAATCTTTTACATTTTAAAAAATTAATTTATTTTGTAAAATTAAAAATTATTAA
AAATGTATTTTTGTTTTTTAATAAACTATTTTATAGCCCTTGATAAATTTATTATTATCA
GATAAATTTATTTAATAAAAATAATTTATGATATTATTTATTGTAAGTAAGCAAAAAATT
GATATATTGATCTTTTATAATTAATATGTTAATTTTTTATTTTGA


>TTHERM_00088030(protein)
MSIQSSNFGSLNKNTLDLQFREYGNIDDVLKYQKSRIIQSSDIEQQQGSGSNNALILSCP
ISHECDSLNNRIIIPNAQTILQETIQTDTANLLGSLEAGNIPQKSGLQKNQSEFLEQKLN
SMKQKHKQLQQQLSEVSKIDSVSNKKKNVVHSQSTQGFFKGGVSTSNLDMFNFGSLKNQI
KQMDVISNILSSIQLKPNNNQQKDIEVIIEKNDLYRILKILIDQLVSYIEKLNQVVSERD
IIDIQRQNAEKLNNELKETIRILEEELKIYKNQSTETKIELEKQKALYDILEKKYLDLLK
RKQEVKIINKETVKEIVIEKPIEILKEINNVRIVKQKKEVRKIIRPQAEVKHTIEKKLHI
LEREKIVPQIQVDRFVEVPRFIPKEVLVDRPVYVDRPVNQFINNNRIQQKIKQKRLKKQL
KCLKQQKKKNQSRDQYLLKNQLTDLQKRKLLLIDQSIFKNLQYIQKKLQKFLRLQKSKKQ
LIDLFTSINHVQKELLKNLYSQINMSQQILSQLIHILLQLFQHNLTHLLLIIRDLYLSKL
VDKITFCHLLILYSKHFLKIQLHLHTLNSMFEKYLFVIVKQYSLIKISLFLKFQISLYLI
ISQSFTFQKINLFCKIKNYQKCIFVFQQTILQPLINLLLSDKFIQQKQFMILFIVSKQKI
DILIFYNQYVNFLF


>TTHERM_00088030(gene)
ATGAGTATATAATCAAGCAATTTTGGGTCTTTAAACAAAAACACACTTGATTTGTAATTT
AGGGAATATGGAAATATTGATGATGTTTTGAAATATCAGAAATCTCGAATAATATAGAGT
AGTGACATAGAGTAATAATAAGGAAGTGGAAGTAATAATGCATTAATTTTAAGTTGCCCT
ATTAGCCATGAATGTGATAGCTTAAATAATAGAATAATTATTCCAAATGCGCAGACTATT
CTGCAAGAAACTATTCAAACAGACACAGCAAATTTACTTGGATCTTTAGAAGCTGGTAAT
ATACCCTAAAAGAGTGGATTGTAGAAGAACTAAAGTGAATTTTTAGAATAAAAACTTAAT
TCTATGAAACAGAAACACAAATAATTGTAACAATAACTTTCAGAAGTATCTAAGATAGAT
TCAGTATCTAACAAGAAAAAAAATGTTGTACATTCTCAATCAACATAAGGATTTTTCAAA
GGAGGAGTGAGCACTTCAAATTTAGATATGTTCAATTTTGGTAGCTTAAAAAATCAAATA
AAATAAATGGATGTGATTTCAAATATTTTATCTAGTATCTAGTTAAAGCCAAATAATAAT
CAATAGAAAGACATTGAAGTTATAATAGAAAAGAATGATTTATATAGAATTTTGAAAATA
TTAATTGACTAATTGGTTTCTTACATTGAGAAGCTAAACTAAGTAGTATCTGAAAGAGAT
ATCATTGATATTTAGAGATAAAATGCAGAAAAATTAAATAATGAGCTCAAAGAAACAATA
AGAATTCTTGAAGAAGAGCTCAAGATTTATAAGAATTAAAGCACAGAAACTAAGATAGAG
CTTGAAAAGCAAAAAGCTCTCTACGATATCTTAGAAAAAAAATACTTAGATCTTCTCAAA
AGAAAATAAGAAGTTAAAATTATCAACAAAGAAACAGTCAAAGAAATTGTAATTGAAAAA
CCGTAAAATAAATAATAAATACTCTTTTTTATAAATTTAATTTAATTTTATTGTTAAACT
AGAATCGAAATACTAAAAGAAATCAACAATGTTAGAATTGTTAAGCAGGTAAAATGTTCA
ATTGTTTTATTTATTTTGTTACTTAATAATTAATATTTACTAGTTAATTTTTATAATTTT
ATTTATATTATATAAAAATTAATGAAGAAAAAAGAAGTAAGAAAAATAATTAGACCCTAA
GCTGAGGTAAAGCATACAATAGAGAAGAAATTGCATATACTAGAAAGAGAAAAGATCGTC
CCTTAAATACAAGTAGGCAATTTTATTCCTACAAAAATAATAATAATTTATCTATTTAAT
TATTAAGGTGATAGAAAAAGTAAAAGAGATTCCTAAGATAGAGTTTGTGGATAAAGAAAA
AGTTATAGAAAAACCATTCTTTGTTGAAAAATTAGTAGATTTATTTGATATAAAATATTA
AAAAAATATCATTAATAAATAATAGGTTGATAGATTTGTTGAAGTACCTAGATTTATCCC
TAAAGAAGTATTAGTAGACAGACCAGTATATGTAGATAGACCTGTAAATCAATTCATAAA
TAATAATCGTATATAATAAAAAATCAAATAAAAAAGGTTGAAAAAATAGTTAAAGTGCCT
CAAATAGTAGAAAAAGAAAAATTAGTCGAGAGACCAGTATTTATTGAAAAACCAGTAAAA
TTAAATTTAAATTCTGATCTAAATAAATAAAAATCAATATTTTATTTTATTAAAGGTTGA
CAGATTTATAGAAAAGGAAACTTTTATTGATAGACCAGTCTATATTTAAGAACCTGTATT
TTTTATTTTTATTTAATTGATATAATATTTATTTAAAATGTTTAAAGCCAGTACATATAG
AAAAAGTTATAGAAGTTCCTAAGATTATAGAAAAGCAAAAAATAATTGATAGACCTATTT
ACATCAATTAACCAGTAATTCTTAAATTTTAAATTAAAATTTAAAATAATTTTTATTGAA
ATAGCGTATAGAAAGAGTTATTGAAAAACCTGTATTCATAAATAAATATGAGCCAATAAA
TTCTTAGTTAGTTAATTCATATTCTACTCCAACTATTTCAACATAATTTAACTCACCTGC
TGCTAATTATTAGAGATTTATACCTGAGTAAATTAGTAGACAAAATAACTTTTTGTCACC
TTTTAATTCTATACAGTAAACATTTTCTTAAGATTTAACTTCACCTTCATACATTAAATA
GTATGTTTGAAAAATATTTATTTGTAATTGTTAAATAGTATAGTTTAATAAAAATTAGTC
TATTCTTAAAATTTCAAATTAGTTTATACTTAATTATTTCCTAATCTTTTACATTTTAAA
AAATTAATTTATTTTGTAAAATTAAAAATTATTAAAAATGTATTTTTGTTTTTTAATAAA
CTATTTTATAGCCCTTGATAAATTTATTATTATCAGATAAATTTATTTAATAAAAATAAT
TTATGATATTATTTATTGTAAGTAAGCAAAAAATTGATATATTGATCTTTTATAATTAAT
ATGTTAATTTTTTATTTTGA