Identifiers and Description

Gene Model Identifier

TTHERM_00945250

Standard Name

ALV1 (ALVeolin 1)

Aliases

PreTt30104 | 173.m00050

Description

Alveolin family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF06246 ) Isy1-like splicing family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00945250

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03122.19.997093137033517e-262hypothetical protein (1667 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00945250(coding)
ATGAGTTTACAAATACCTTAACAATAGTTTAACTCTCTTTCATCAAAAGCGCTTAATTCT
ATTTCAAATAACAATGATAATCTAAGCTCGACTGAAAGGTTGAATACTAGTAGTAATTAG
AACCAATAGAAGCAACAAGCTCTTCTCTTTACTCCAAATAGCTAAAATACTTAAAAATCT
ATGACTCCATAGCCTCATTTGTAGCAATAATTCCAGTAAGTAGGACTAGTTTCTCCAAAT
ATTTACACTAATAGCTCTTCATTATAGAATAATAATGCAAATATAAATACTTCAAATATG
AGGTTTTAGAAAAACTTAAATAGTTTGGCATTTAACAATCACAATGACATAAAGAATTAA
TAAACTTAGCTAATAGTACATCATTAAAATAACAGCAGCAATAATAGTGAGTCACTATGT
TCAGATCTGAGAAGCTTTTTTCAGGACAACATTAGTGGAATAAATAGTTAATTTACAGGA
ACTCTTTCTGTAAATAAAAACAATAATAACAATTATTCTAGCATAATTCAAGGAAGCAAA
AATGGTAGTATGAATAGTAATTAGCATCGCATTTAAGTAATGACTCCTTCTACTAATGAT
GATAAATCGATACTTTCTTAAAATAATCACTTCATAAGCACTAACCCTAAATAAGTAGAT
TTAAGCTCTTCTTCTTAATCCCATCATAATTAGCACTTGCTTCATTCTCAAGTTCATAGC
AAAAATGTCTCTCAAACAACACAAATGTCTGTATTTAACAACAGCGGCGAAATATCATAA
TTCAACTACTCTTCTCTAGGAAATAACTAAAACTTTCAATCATAGAATTAAATGAGCAAC
ATAAGTTCTGTAATTAATAACATAAACTTTGAAAATGATACTCTTTCATCATCATAATAG
TAAAATACTTCCATATCAAATATTAGCAATACATTATAAGAAGCTAAATGCAGATTCCAT
CCTTATAAAAAGGTGAAGTATTAAATGAGCTAAAATGAAAATGAGAAATTCTGCACTGCT
TGCGCGTTAGAATACGCAAAATAAGGATTGGATGTAGAACCTATTATTAAGACTTAATAA
AAAGAGATTAACTTATACATGAATGAAATGCTTAATGTCAAAAATATTAATGACATGCTT
ATGAATTCTTTGGACTCCAAGCAAGAATTTATAAAAGAGCACAGTCGAAAACAGTCTCAA
ATAGTCCAAGATTTATTTCTACAAATTGAAAAATTGATCTATGAACAAAAAACACAGCTA
CTGAGTTAAATAAATAACAAAATGTGGGAGCAAATAAATTTAATTGAACTGAAGAAAAAC
GACTCTAGGCTTTTCGAATAAAAGCTACTTCTCAAGCAATAAGATATTGAAAAAAACTAT
CAATAAATCACTACTGCTATGGGCGTTTCTGAAGTGAGAGAAATTCTCTTTTTCTACAAT
TCAGAACTGGACCAAATAAAAACTAGCATAAGCGACATGTTTAAAAACACTTCTTTTGAT
TTAATTAATCTTAACTAAAATTAAATAGCCTAGCAAATTTAGATTCTCTAAAAATTTCTC
CAAGAGGAAGTTTTCAAGCCCACAATAACTCAATCAACTCTTTAAGAAAGCATTAATTTA
TTGTCTAACAAAAGCAATTCTCCATCAAAAAATGATAAAAATTAATTGTCTCGTTTCATG
AGTAACTAAGATAAAAAGGGATCTGGTAAAAAGCAGTAATATCAATAACAATAAATATAA
AATAAAACACTAGCTTAACAGCTTTAAAATTATCACATTGAACAATCTTAATTACAACCT
AATGTATAGAAAGTAATTGAATTAAATTGTGCTATGAATAAATAAAATACATAATCATAA
AATTTGTAAAAATAAAATTATCAATAAAATGAATAAATGAACTTTAATCAATAAAAAGAA
CAGTAATAAATGTTTGCAACACAGTTATAATAAAAGCAACTCTAATAACAATAATAGTAG
TAATAGTAATACAATGAAATAGTAGATACTTCTATCAGCGAAAAACAACACACGTAAGAA
AGCGATGACTTATCATCTGCATAAGGAATATACTTGAATATTTAGAACCAAAGCAAAATT
TCTAATAAAAGTAACATAAGCTCTCATAAAATAATAAATTATTCAGACATACATGATGAA
TAAAACTTGAATATTTTAAAGGATTCCTCTTCTCCTTCAACCTCAGCCAAATAAATCGTT
AGAGATTCAAAGGCTACTCCAGTAACTCAAGAAAAGAAACCATTCTTCCCTTTCTAATGC
TTAAGTCCTCAGCAAACTTCAAAGGGAGAAGGAACTTTAAGATAATAATACTCTATTAGC
AAAGATAATTAGCTCAATTAAAGACAGAAACAGTTTATTCAAACAGAACCAACTCACCTA
CCTTCTAATAAAACTAAATAAGGAATCTCTAAGCCAGGCAATTATTAGAGAAATTTGTTA
ATGAATGATGAAATAGCTACTTCAAACAACAGATTTAAGTTTAATTAAAATCCCACCAAT
AACTTCAGTCTCCTCACTCATTTCAATAAGTAAACAAACTCGAATATTTAAAATTTAGTT
GCAGTTCCTCAAATTAACAATAAACAATAAGAGTAAGCCTAAAATTTTACCAATTAATCT
AAACTAAATGCAATTAACAACATCCGCTAGCTCCAAATAAATTTAGTTGACTAGGATAGT
AATTAAAAATCACTGACCTCAAGACCTATAATTATGAATCAAATCAACAATAACCAGTAA
TTTGCAAATAGCTAAAATCAGTAACCAAATTTTGTGGCTTAATTGATTTAGTAAAAGCAA
TAATAGAATACTTTAAAGAATACACCAAATTATTAATAATTACAAAACAATGATTATAAC
AGCATGTCTTCATTAAAAAATTGA


>TTHERM_00945250(protein)
MSLQIPQQQFNSLSSKALNSISNNNDNLSSTERLNTSSNQNQQKQQALLFTPNSQNTQKS
MTPQPHLQQQFQQVGLVSPNIYTNSSSLQNNNANINTSNMRFQKNLNSLAFNNHNDIKNQ
QTQLIVHHQNNSSNNSESLCSDLRSFFQDNISGINSQFTGTLSVNKNNNNNYSSIIQGSK
NGSMNSNQHRIQVMTPSTNDDKSILSQNNHFISTNPKQVDLSSSSQSHHNQHLLHSQVHS
KNVSQTTQMSVFNNSGEISQFNYSSLGNNQNFQSQNQMSNISSVINNINFENDTLSSSQQ
QNTSISNISNTLQEAKCRFHPYKKVKYQMSQNENEKFCTACALEYAKQGLDVEPIIKTQQ
KEINLYMNEMLNVKNINDMLMNSLDSKQEFIKEHSRKQSQIVQDLFLQIEKLIYEQKTQL
LSQINNKMWEQINLIELKKNDSRLFEQKLLLKQQDIEKNYQQITTAMGVSEVREILFFYN
SELDQIKTSISDMFKNTSFDLINLNQNQIAQQIQILQKFLQEEVFKPTITQSTLQESINL
LSNKSNSPSKNDKNQLSRFMSNQDKKGSGKKQQYQQQQIQNKTLAQQLQNYHIEQSQLQP
NVQKVIELNCAMNKQNTQSQNLQKQNYQQNEQMNFNQQKEQQQMFATQLQQKQLQQQQQQ
QQQYNEIVDTSISEKQHTQESDDLSSAQGIYLNIQNQSKISNKSNISSHKIINYSDIHDE
QNLNILKDSSSPSTSAKQIVRDSKATPVTQEKKPFFPFQCLSPQQTSKGEGTLRQQYSIS
KDNQLNQRQKQFIQTEPTHLPSNKTKQGISKPGNYQRNLLMNDEIATSNNRFKFNQNPTN
NFSLLTHFNKQTNSNIQNLVAVPQINNKQQEQAQNFTNQSKLNAINNIRQLQINLVDQDS
NQKSLTSRPIIMNQINNNQQFANSQNQQPNFVAQLIQQKQQQNTLKNTPNYQQLQNNDYN
SMSSLKN


>TTHERM_00945250(gene)
ATGAGTTTACAAATACCTTAACAATAGTTTAACTCTCTTTCATCAAAAGCGCTTAATTCT
ATTTCAAATAACAATGATAATCTAAGCTCGACTGAAAGGTAAAGATTGCTTATTTATACC
TTAAAAATCATTTATTTATTTATTTATTTTCTTTTTTTTGATTTGATTTTTTGATAGGTT
GAATACTAGTAGTAATTAGAACCAATAGAAGCAACAAGCTCTTCTCTTTACTCCAAATAG
CTAAAATACTTAAAAATCTATGACTCCATAGCCTCATTTGTAGCAATAATTCCAGTAAGT
AGGACTAGTTTCTCCAAATATTTACACTAATAGCTCTTCATTATAGAATAATAATGCAAA
TATAAATACTTCAAATATGAGGTTTTAGAAAAACTTAAATAGTTTGGCATTTAACAATCA
CAATGACATAAAGAATTAATAAACTTAGCTAATAGTACATCATTAAAATAACAGCAGCAA
TAATAGTGAGTCACTATGTTCAGATCTGAGAAGCTTTTTTCAGGACAACATTAGTGGAAT
AAATAGTTAATTTACAGGAACTCTTTCTGTAAATAAAAACAATAATAACAATTATTCTAG
CATAATTCAAGGAAGCAAAAATGGTAGTATGAATAGTAATTAGCATCGCATTTAAGTAAT
GACTCCTTCTACTAATGATGATAAATCGATACTTTCTTAAAATAATCACTTCATAAGCAC
TAACCCTAAATAAGTAGATTTAAGCTCTTCTTCTTAATCCCATCATAATTAGCACTTGCT
TCATTCTCAAGTTCATAGCAAAAATGTCTCTCAAACAACACAAATGTCTGTATTTAACAA
CAGCGGCGAAATATCATAATTCAACTACTCTTCTCTAGGAAATAACTAAAACTTTCAATC
ATAGAATTAAATGAGCAACATAAGTTCTGTAATTAATAACATAAACTTTGAAAATGATAC
TCTTTCATCATCATAATAGTAAAATACTTCCATATCAAATATTAGCAATACATTATAAGA
AGCTAAATGCAGATTCCATCCTTATAAAAAGGTATTTATTTGTAGAATTAAATATAATAA
CCTAAATAAAATTTAAAAAAATAAAGGTGAAGTATTAAATGAGCTAAAATGAAAATGAGA
AATTCTGCACTGCTTGCGCGTTAGAATACGCAAAATAAGGATTGGATGTAGAACCTATTA
TTAAGACTTAATGTAATTAAATTTTAATTTACAAATTTGAAAAATTAAATCTTTAACTGA
GAGGGAATTTGTTAAATTTATATTTATCTGCAAATAAATCTTCAATCAATCAATTAATTA
ATTAAAAGAAATAAATCAAAATAGATTTTTTATTTCTTCATATTTTTAATTTTTTTAATT
CAATTATAATAATAGAAAAAGAGATTAACTTATACATGAATGAAATGCTTAATGTCAAAA
ATATTAATGACATGCTTATGAATTCTTTGGACTCCAAGCAAGAATTTATAAAAGAGCACA
GTCGAAAACAGTCTCAAATAGTCCAAGATTTATTTCTACAAATTGAAAAATTGATCTATG
AACAAAAAACACAGCTACTGAGTTAAATAAATAACAAAATGTGGGAGCAAATAAATTTAA
TTGAACTGAAGAAAAACGACTCTAGGCTTTTCGAATAAAAGCTACTTCTCAAGCAATAAG
ATATTGAAAAAAACTATCAATAAATCACTACTGCTATGGGCGTTTCTGAAGTGAGAGAAA
TTCTCTTTTTCTACAATTCAGAACTGGACCAAATAAAAACTAGCATAAGCGACATGTTTA
AAAACACTTCTTTTGATTTAATTAATCTTAACTAAAATTAAATAGCCTAGCAAATTTAGA
TTCTCTAAAAATTTCTCCAAGAGGAAGTTTTCAAGCCCACAATAACTCAATCAACTCTTT
AAGAAAGCATTAATTTATTGTCTAACAAAAGCAATTCTCCATCAAGTAAAAATTAATTAA
TTGTGTTTTATTATAAAAAATATTTTCTTAATTAGATATTTTATTAATAAAATTAAAATA
TTCCTTCATAATAAAATAGAAAATGATAAAAATTAATTGTCTCGTTTCATGAGTAACTAA
GATAAAAAGGGATCTGGTAAAAAGCAGTAATATCAATAACAATAAATATAAAATAAAACA
CTAGCTTAACAGCTTTAAAATTATCACATTGAACAATCTTAATTACAACCTAATGTATAG
AAAGTAATTGAATTAAATTGTGCTATGAATAAATAAAATACATAATCATAAAATTTGTAA
AAATAAAATTATCAATAAAATGAATAAATGAACTTTAATCAATAAAAAGAACAGTAATAA
ATGTTTGCAACACAGTTATAATAAAAGCAACTCTAATAACAATAATAGTAGTAATAGTAA
TACAATGAAATAGTAGATACTTCTATCAGCGAAAAACAACACACGTAAGAAAGCGATGAC
TTATCATCTGCATAAGGAATATACTTGAATATTTAGAACCAAAGCAAAATTTCTAATAAA
AGTAACATAAGCTCTCATAAAATAATAAATTATTCAGACATACATGATGAATAAAACTTG
AATATTTTAAAGGATTCCTCTTCTCCTTCAACCTCAGCCAAATAAATCGTTAGAGATTCA
AAGGCTACTCCAGTAACTCAAGAAAAGAAACCATTCTTCCCTTTCTAAGTAAGATTACAC
TACTATTTTAATTTATTAATAAATTTTTATTTAAAAAAAGTGCTTAAGTCCTCAGCAAAC
TTCAAAGGGAGAAGGAACTTTAAGATAATAATACTCTATTAGCAAAGATAATTAGCTCAA
TTAAAGACAGAAACAGTTTATTCAAACAGAACCAACTCACCTACCTTCTAATAAAACTAA
ATAAGGAATCTCTAAGCCAGGCAATTATTAGAGAAATTTGTTAATGAATGATGAAATAGC
TACTTCAAACAACAGATTTAAGTTTAATTAAAATCCCACCAATAACTTCAGTCTCCTCAC
TCATTTCAATAAGTAAACAAACTCGAATATTTAAAATTTAGTTGCAGTTCCTCAAATTAA
CAATAAACAATAAGAGTAAGCCTAAAATTTTACCAATTAATCTAAACTAAATGCAATTAA
CAACATCCGCTAGCTCCAAATAAATTTAGTTGACTAGGATAGTAATTAAAAATCACTGAC
CTCAAGACCTATAATTATGAATCAAATCAACAATAACCAGTAATTTGCAAATAGCTAAAA
TCAGTAACCAAATTTTGTGGCTTAATTGATTTAGTAAAAGCAATAATAGAATACTTTAAA
GAATACACCAAATTATTAATAATTACAAAACAATGATTATAACAGCATGTCTTCATTAAA
AAATTGA