Identifiers and Description

Gene Model Identifier

TTHERM_00923000

Standard Name

ALT2 (Alpha-Like Tubulin 2)

Aliases

PreTt21179 | 164.m00072

Description

Alpha-tubulin-like protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00091 ) Tubulin/FtsZ family, GTPase domain
  • ( PF03953 ) tubulin/FtsZ family, C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.7%

TetraMine Data

TTHERM_00923000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19838.11.9995739544551218e-152tubulin/FtsZ family, GTPase do
main-containing protein (460 a
a)
WormBaseWBGene000065294.999238967328776e-115locus:tba-2 Tubulin alpha-2
chain status:Confirmed Uni
Prot:P34690 protein_id:CAB16
856.1
OxytrichaContig21024.0.g665.001313616964319e-114Tubulin/FtsZ family, GTPase do
main
DictyBaseDDB_G02876892.0007666164339447e-112tubA on chromosome: 5 position
707217 to 708704
SGDYML085C3.0014466598835893e-101TUB1 Alpha-tubulin; associates
with beta-tubulin (Tub2p) to
form tubulin dimer, which poly
merizes to form microtubules
Stentor CoeruleusSteCoe_148411.5400882849875202e-51

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00923000(coding)
ATGAAATAAATTATTACCATTTGCTTAGGCTAATGTGGAATAAGAATTGGTAATTAAGTA
TGGAAATTATTTTGTGAAGAGCATAAAATTGAATTATCTGGGATAAAAAAATAGTCTGAA
AACACCTTAGAATAAGAAAACTTATTATCATTTTTTTAAGAAAGTGTATCAGAAAAAATA
ACACCTATTTCAGTTTTTATCGATTTAGATACAGAATAAATTGATGAAATAAAAAATGGT
TAGTGTAGGACACTTTACAAACCTGATTGTCTTATATCATCTAAAGAAGATACTGGAGGC
CTTTTTTCAAGAGGTTATTATACAGCTGGTAGGTCTATTTTAGATCATTCTATTGATTAA
ATACGTAAAATTGCTGAAAGCTGTAGCTACTTGCATGGTTTTATAATTTATTCAACTTCA
AGTGGAGGAGCTTCTTCAGGATTAGGAAATTTAATTTTATAACGCCTTAGAGTTGATTAT
GGTTAAAAAATACCTATCATATTTTTTTAATAAATTCCATGCAATTTAAACTAATCTTCA
GTATTTTCGTTTTATAACTCAACTTTAAATTTAGGCAGCTTACTTGAGGAATCAAGCTTA
AATATTTTATTCTAAAATGAATCTTTGTATAAAATATATGAAAATTAGTTTGATTTTGAA
TATCCATCATTTAATGATGTCAATCGCTTAGTTTCATAAGTAGCATCGGCAACTACAAGT
TCTATCAGATTTAAAGGCGATCTAAATTTTGATCTTAATTAATTGATTATGAATTTGGTA
CCATACCGTAAAATAAATTTAGTTATTCCTTCATATTCTCCTTCGACTGATAAAAATAAT
TAACAAAACTAGTAAATGAGTGTAAATAGTATGACTAATTAGCTTTTTAAAAATGATTTT
AGTTTTATCAATTGTAAAATTAATGCAAATATATACATGGCTTGTTCATATATGATCAGA
GGAGATATAGTGCCAAGAGAAGCACTAGAGTCGATATATAATTTAAAAAAAAAGAAAAAT
ATTAAATTTGTTGATTGGTGTTCTAATAGCTTTTTGCTAGGAGTTAACTCATTTAAACCT
ATTCCTATCATAATCGAAGAAAAATCTTTCTCTTCTTCAGTAGATGGTTGCATTTTAGCT
AATAGCTGTGGTGTATAAGATGCTATAGATTTTATTGGTACCAAATTTGATTTAATGTAT
TCTAAAAGAGCTTTTGTTCATTGGCATTACGGTGAAGGCCAAAGTGAAGGCGATCTACAA
GAAGCAAGAGAAATTTTAGCTTCAATAGAAAAAGACTATGAAGAAATTTCAAAAGATTCT
TATACATTATAGTTAGAGGAAGATTATGAATGA


>TTHERM_00923000(protein)
MKQIITICLGQCGIRIGNQVWKLFCEEHKIELSGIKKQSENTLEQENLLSFFQESVSEKI
TPISVFIDLDTEQIDEIKNGQCRTLYKPDCLISSKEDTGGLFSRGYYTAGRSILDHSIDQ
IRKIAESCSYLHGFIIYSTSSGGASSGLGNLILQRLRVDYGQKIPIIFFQQIPCNLNQSS
VFSFYNSTLNLGSLLEESSLNILFQNESLYKIYENQFDFEYPSFNDVNRLVSQVASATTS
SIRFKGDLNFDLNQLIMNLVPYRKINLVIPSYSPSTDKNNQQNQQMSVNSMTNQLFKNDF
SFINCKINANIYMACSYMIRGDIVPREALESIYNLKKKKNIKFVDWCSNSFLLGVNSFKP
IPIIIEEKSFSSSVDGCILANSCGVQDAIDFIGTKFDLMYSKRAFVHWHYGEGQSEGDLQ
EAREILASIEKDYEEISKDSYTLQLEEDYE


>TTHERM_00923000(gene)
ATGAAATAAATTATTACCATTTGCTTAGGCTAATGTGGAATAAGAATTGGTAATTAAGTA
TGGAAATTATTTTGTGAAGAGCATAAAATTGAATTATCTGGGATAAAAAAATAGTCTGAA
AACACCTTAGAATAAGAAAACTTATTATCATTTTTTTAAGAAAGTGTATCAGAAAAAATA
ACACCTATTTCAGTTTTTATCGATTTAGATACAGAATAAATTGATGAAATAAAAAATGGT
TAGTGTAGGACACTTTACAAACCTGATTGTCTTATATCATCTAAAGAAGATACTGGAGGC
CTTTTTTCAAGAGGTTATTATACAGCTGGTAGGTCTATTTTAGATCATTCTATTGATTAA
ATACGTAAAATTGCTGAAAGCTGTAGCTACTTGCATGGTTTTATAATTTATTCAACTTCA
AGTGGAGGAGCTTCTTCAGGATTAGGAAATTTAATTTTATAACGCCTTAGAGTTGATTAT
GGTTAAAAAATACCTATCATATTTTTTTAATAAATTCCATGCAATTTAAACTAATCTTCA
GTATTTTCGTTTTATAACTCAACTTTAAATTTAGGCAGCTTACTTGAGGAATCAAGCTTA
AATATTTTATTCTAAAATGAATCTTTGTATAAAATATATGAAAATTAGTTTGATTTTGAA
TATCCATCATTTAATGATGTCAATCGCTTAGTTTCATAAGTAGCATCGGCAACTACAAGT
TCTATCAGATTTAAAGGCGATCTAAATTTTGATCTTAATTAATTGATTATGAATTTGGTA
CCATACCGTAAAATAAATTTAGTTATTCCTTCATATTCTCCTTCGACTGATAAAAATAAT
TAACAAAACTAGTAAATGAGTGTAAATAGTATGACTAATTAGCTTTTTAAAAATGATTTT
AGTTTTATCAATTGTAAAATTAATGCAAATATATACATGGCTTGTTCATATATGATCAGA
GGAGATATAGTGCCAAGAGAAGCACTAGAGTCGATATATAATTTAAAAAAAAAGAAAAAT
ATTAAATTTGTTGATTGGTGTTCTAATAGCTTTTTGCTAGGAGTTAACTCATTTAAACCT
ATTCCTATCATAATCGAAGAAAAATCTTTCTCTTCTTCAGTAGATGGTTGCATTTTAGCT
AATAGCTGTGGTGTATAAGATGCTATAGATTTTATTGGTACCAAATTTGATTTAATGTAT
TCTAAAAGAGCTTTTGTTCATTGGCATTACGGTGAAGGCCAAAGTGAAGGCGATCTACAA
GAAGCAAGAGAAATTTTAGCTTCAATAGAAAAAGACTATGAAGAAATTTCAAAAGATTCT
TATACATTATAGTTAGAGGAAGATTATGAATGA