Identifiers and Description

Gene Model Identifier

TTHERM_00127130

Standard Name

ALG8 (Asparagine-Linked Glycosylation 8)

Aliases

PreTt09376 | 9.m00397 | 3699.m00106

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00127130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09130.21.9999590304423412e-72hypothetical protein (1080 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00127130(coding)
ATGGATGAATAAAATTTTCATTAGAAAGATAACAAAGAGAATAATCATAGTACTGACTTT
GAAGTTCATCGAAACTGGCTCCGTATTACCTATAACTTGCCTTTAAGAGAGTGGTATTAT
GATGATGTATCGATATGGACTCTTGACTACCCTCCTCTGTTTGCATATTTTGAATACATT
TTGACATTTCCTGCTCGTTTCTTTGATATGAAGATGCTAGAAACCAATCAAGAATATAAA
AGTGAAAATACTGTAATATATTAAAGAGCGACTGTGATGATTAGCGATCTTCTATTTTTA
TATGCAATCTGTAACTTCATAAAAGTCAGCTTTGGTAAAAATAAGTAAAATTATGCTTAT
GCAGTCCTGTTCACTTTCCTTTAGTTCGGTTTCTTGCTTGTTGATAATATCCATTTCCAA
TACAATTAATTCTTATAGGGTATTTTTATACTTTCCTTAACTAAATTTATCGAGGGAAGA
AACATATTCGGAGGAATTCTCTTTGCATTGGTTCTTTGTTTCAAACACATATTTCTCTAT
TCTGCACCTGCGATATTTTTCTTCTTACTAAAGTTTTATTGCTTTGATAATGGCAATAAA
TTAAACATTAGAAATTTCTCTAAGTTAGGGATGAGCGTCGTTACAGTATTCTTGATTTCG
TTTCTCCCCTTTTTAAGCTTGGATGCAATCAAGTAAATTTTAAGCAGAATGTTTCCCTTC
TAGAGAGGACTAGTTCATGCTTACTGGGCACCTAATTTTTGGGCTCTTTATTGCTTCGCT
GATAAGGTGCTTTCAACATTAGCAAGAAAATTGCTTAAAATACCCATAAGTTCTAAGAGT
ACTTTGACAAGTGGCGTCGTTCAAGTGACTTAATTTGATATTCTACCAGAGATAAAGCCA
ATATACACAATAATGGCTATAATTATTATATCATTACCTCTTTGGTATAAGATAGTCAGA
AACCCAAAAGCATAAAACATCTTGCTTTATAGCAGCATCTAAATGTTTATATTTTACATG
CTAGGCTATCATGTCCATGAGAAAGCAATATTACTCCCTCTAGGAATCTATCAGTTATGG
GCGATAGGAAAATAAAGTAGAAGCAGATTTGTATTGCTTTTCTCATTCGTAAGCGGCGTA
GGCTTACTTCCACTACTTCCAGAGCATTCTGAAACTGGACTTAAAATCATTGGACTATTC
ATTTATCATCTAGCATATTGGGCTTACCTAAGAAGAGATTGCTACAGAGAAGCTCAGAAT
TTAGATGATTACAAAAAATTTGGAATGAATTTTTTTGCAAAGTTTATTATATTCTCTGGG
ACAATAATTGCAATCTATGGAAATGTTCTTCATTACATTCTTTTTTTGAAATCAGAAAAC
AAGTTTGAATACCTACCTCTTATGATCCATTCAGTTTATGGAGGTATTTTGAATTTGTAC
TTCATCATTGAAATGTACTTAGAACTATTTAGGTCTCAAAATTAAATTTCAATATAAGAA
GTAAAATAATGA


>TTHERM_00127130(protein)
MDEQNFHQKDNKENNHSTDFEVHRNWLRITYNLPLREWYYDDVSIWTLDYPPLFAYFEYI
LTFPARFFDMKMLETNQEYKSENTVIYQRATVMISDLLFLYAICNFIKVSFGKNKQNYAY
AVLFTFLQFGFLLVDNIHFQYNQFLQGIFILSLTKFIEGRNIFGGILFALVLCFKHIFLY
SAPAIFFFLLKFYCFDNGNKLNIRNFSKLGMSVVTVFLISFLPFLSLDAIKQILSRMFPF
QRGLVHAYWAPNFWALYCFADKVLSTLARKLLKIPISSKSTLTSGVVQVTQFDILPEIKP
IYTIMAIIIISLPLWYKIVRNPKAQNILLYSSIQMFIFYMLGYHVHEKAILLPLGIYQLW
AIGKQSRSRFVLLFSFVSGVGLLPLLPEHSETGLKIIGLFIYHLAYWAYLRRDCYREAQN
LDDYKKFGMNFFAKFIIFSGTIIAIYGNVLHYILFLKSENKFEYLPLMIHSVYGGILNLY
FIIEMYLELFRSQNQISIQEVKQ


>TTHERM_00127130(gene)
ATGGATGAATAAAATTTTCATTAGAAAGATAACAAAGAGAATAAGTTAGCTTACAAGCAA
TTAAGAATATATTGATATTTAAATAAAATTAGTTTTCAAACATTCTCAAACATATTTTAG
AAACTTTTTTATTGTGTTTTATTTAAATATTGCTTAAGAGGACAACTCATTTTGATTATT
TTTTTATCCATTCTAATTTTATTGATTCATTTATTTATTCATTGATTTATTTATTTTTTT
ATTGATTTATTGATTCATTTATTTATTAGTTATTCTTTTTTAATTGAAAATCATTCAATA
TTACTTGGGTTTGATAACATCTAAAGTACATAGTTTTTAATGTAGAGTTGGTCAAGCTTA
CTTGCTTTCTTTTTGCAAGCAGTTATGCCAAGCTGGAAGAGACAATACCTTTGGAGGTAC
ATACGATTCGTTTTATTAAAATAATTAATTTTACCAATGTATTGGTTGATTTCTTAAATT
TTTATTGGATTATCGAGCAAGTACTAACTCAAATAAGTAGAATTTTACTCAAATATTTGA
CTATTTTCTTCAGGGAAAATTTATTTGAATTATTCTAAGTTTGTAAAGCTTTTAATGATG
GTGATGATGTAAGTTATTTTACGTTACTTTATCAGCTTTAGCTTTGAATCAAGCTCTTTC
ATATTCTCATCTATTTCATCAAAGCTTATTTCATCAATTTCTTTCAAAAAGTGAGAAAGA
TCACTTTTCGTAAACCTATTCTTGAAAGCATCTAGATACCTAATGTGCTACTCATTAATT
ACCCTATTAGCTTCGTTATCAACGATTTTAATTTACAATGAAATCTACTCTTTTATATAT
TTGCTTGACTAAAGCATAAAAATTTTAAGCTAGTTATGAAATTGCAATTTCTTTTAAAGT
TCTGATTCAGATAATTTCTAGAAACTTGCTATTTGAATATCTTTTTCTTAACCTTTTCTG
AATCTAATCAAATCTTTCGTATCTGAATATTTTTTCGGCTTTTTCTCTATCTGTTTTTTA
AGTTTACTGAGATGTCCATGAGTTTCTTTAAACTTTTATGTTTTATTATAAGCATCAATG
ATTCTTTGGAGTTAGGTTTGTTTACCACTGGTTTGCTAATCTAAATTGTAATCATTATTT
GCTTATTCTATCTTGATTTGATTCTCTACAACCTAAAAGCTTTACTATGATATATCTAAA
ATTCTAGATTCGTTTTTATTATATGCAGTATTTGAATTGTTTTGGTTTTCCTCAATCATG
CTACTAACTTGTTTTGAACCAAAACCTTCTCCTCTATTACCTATTAGATTTAAACATGCA
GCATTATGCTCTTCTTTGATAACAATTTGCAAAGGATCTAAATTCTAATTTAATTATTGC
TAACCCTAAAGTAGAGACTCGTGATTTCGAATCTATTATGACTAATAGTTAGAATATAAA
TATTCTTTTGTTTCAAACTAATAAGGGGGAGGAGGTGGATGAATCTAATTTTATTTTTGA
CAAATAATAGATAAAGCTGAATGGGGAAAAGCTTAACAAGGATTAATAATTTTTTCAAGA
TAATTCTATTGTAATTTATTTTCAAACTATTAGCAATAATTAATTTTTCTTTACAATGCA
TTTTCATATTAAGCTTGATTAAACTAATACTAATGGTTGTTCAGGATAATTGGATGGTCA
GCATTCTCGCTTTCTTTTTTTATTAATATTCCATTTTATTATAATTCATGATTGCTTTGA
CTTTCTCCAATTTAATTAATAATTTCTGTACTTTTTAACTAATTATCGTCAAAGTTTTGA
TTTTATTATTTATCGCTTAATTTTACAAATTAACTAGAATTCTAATCAGAATTAGTTTAA
CCATTTTCAGCTAATGAAATGGCTATGTTCTTGTCCTATTTCTCTGATGCATCATATTCT
AACTTGATATTATCATCCTAAAGGGGCTTAATTAAACTGGCTTAAGAACTTAACTAAAGT
TAGGTACTATGGTCTGCAGAATTTGTTTTGTTTTCTCCTTATTTATTTGCTTTATATGTT
GCTGACTTCTATTTTTGCTATTATATTTTTTTTTAAATATCCTCTTATTCTTCCAGATTG
ACAAATAGCTAAGATTAGATTTCACGTTTTCTTTGCTCGAGGTCTAAACAATCTTATATG
GCTTGCAATAGCTATTGACAAAATTCTTTCTAATCTTACAAATTGTTACTTTCTTTCTAG
ATAAGCCTAACAAGTTCTTATCTGATTTTTTACTTCATTTCAAGTAATACTTTTTTTTGT
TATAATGTATTTTTTAGATTTTCAAATTCCTGATTAGTCAAAATTAATTTCTATTCAAGG
TTATCATCCTCTTCGGGCTCATGACCTGGGTGAATTAAATTTTTTTATTAATTCATTTAA
GCATGGAGCATGTAATTTTAATTATATCTATCATTCGATGTATCAACTCCTATTCTTTCA
TATTAGTTATTATATCTATTGAAATATTGTCTTTATACAAAATTCTCTCTATTACCACTA
AAGCAATTCTAATTTAATTAATTTGGATTTTAGATATTTTAATTAATATTTTTGGAAATT
TATCCTTTATATTCTAATTATTGTGGGGTGTAATTATAATTTGATATATCATTTGATATT
TTCATAGTCTTTAAATTTTAATTTGGTAAAAAAATCATCTAAGCATTTACTTCGCTTTTA
TCTTCGCTTAGCTCGGGAATAATTTATTATTGATCAAGCTGAAATTGCTATAGAGGTGGT
TAAAATTAATACCTAGAATACCTATTATTAATTTCCTCTGGCTTGAGATGTTCTTCAGGT
TAATGATTTTCATAGATTTTATTATATTACTATTTATTTGGTATAATTTTGTTATGGTAG
CCCAGTATTCTAGAAGGATTAATTGAAGATTAATTATAATAATTAGGGTTAAGAATAGAG
GAATTTTAAATTTTTTATTAAGAAATTTTATGATTCTATATATCAGGTATAGCTGTATTA
ATCTTTTAGATGTCAAATTCTTTTTTTGACAAAGGCACTGCTAATTCTATTTATTTGTCA
TATTAAAAATGACCTTATGTAATAGACTAATCATTTGCCTGTAAATAGCTTTCCTAAACC
ATCTTTTCTTGATTTACCTCCAAATTCTTTCCATAATGAGCTTTAGTAGAAAGTTCCTCT
TAAATTTCTATAGAATTTTTTAAATAATTCTCTTTAATGGTGTCAATCATTTTTTACTTC
AATCGATCAATCGAACTATGCGTCTCTTAATTCAATCTAATTTTAATCTTTAATATTATT
TTAATTCAAAATAAATCCAATATTTTGTGATTAGTAACTTCAATATGCTAGATTTTTGCC
CAATAATTTTTTGATAAGATGCTAATGTGAAAGATCGATCTATTCTTTTTTTTCACCTAT
TTTTTTTAAGTTTTTTCTTAATAAAAAGAATTCTTTATCAAATTTTTATTTAGTAGAAAA
AAGGTAAAGTCTTGGAAAAAAAAATCGATGTTTGATTTAGTTGCTATTTGCTTTTTAATA
AAGCTCTTGTTGGTATTTGCTTAGTAAAAATTTGACCTTTAGATTTTTTTAAACAAACAA
TTAAACCCTCAACATAAATTTAACGCTTATCGAGATTCATAAACCCTATTTATAGATAAA
CTCCAACGCATAAAAACTACTCTAAATTAACTTCATTTTTAATTATAGTCATAGTACTGA
CTTTGAAGTTCATCGAAACTGGCTCCGTATTACCTATAACTTGCCTTTAAGAGAGTGGTA
TTATGATGTAATTAGATTAATTTCAAAATTATGCAACAAATCGATTATTTTCTACAAAAT
AACATAAAAATTAAAAGGATGTATCGATATGGACTCTTGACTACCCTCCTCTGTTTGCAT
ATTTTGAATACATTTTGACATTTCCTGCTCGTTTCTTTGATATGAAGATGCTAGAAGTAC
TTAGAAGTTTAATATCTTTTCTATGTATTTGATTAATATCTTAATTTAATACTGAATAGA
CCAATCAAGAATATAAAAGTGAAAATACTGTAATATATTAAAGAGCGACTGTGATGATTA
GCGATCTTCTATTTTTATATGCAATCTGTAACTTCATAAAAGTCAGCTTTGGTAAAAATA
AGTAAAATTATGCTTATGCAGTCCTGTTCACTTTCCTTTAGTTCGGTTTCTTGCTTGTTG
ATAATATCCATTTCCAATACAATTAATTCTTATAGGGTATTTTTATACTTTCCTTAACTA
AATTTATCGAGGTAAATTAACTAAAAATAATTACTAACTGTATTACTCAATTTGAAGACA
TTTATTCCGCTCTTAATACATAAGCTAATTCAAAACGAATGAAAAGTACATTAAGGGGCT
TTATAAAATTTAATCTTATTAGTGTTAGGCTTAATTTACTTTATTATTATTAAAATTCAA
AAATAACACTTATACTCAATTTATTTAAGCTAATTTCATCAAAAATAAAGGGAAGAAACA
TATTCGGAGGAATTCTCTTTGCATTGGTTCTTTGTTTCAAACACATATTTCTCTATTCTG
TAACAAAAAGAAACGAAAAGTTAATTAAAAAATTGAATAAAACTTAATTAAAATTAGGCA
CCTGCGATATTTTTCTTCTTACTAAAGTTTTATTGCTTTGATAATGGCAATAAATTAAAC
ATTAGAAATTTCTCTAAGTTAGGGATGAGCGTCGTTACAGTATTCTTGATTTCGTTTCTC
CCCTTTTTAAGCTTGGGTAAAAATTAAATTTCATAATTAGCTACTAGCAAAATATATATT
TATTTTTATAAATTAGATCCTAATTCTTTAAATAAATTTTAAAAAGAGAATTAGTTGCTA
CTTTAATTAATTTTTTGTCAATTATAAATTGTTTAGATGCAATCAAGTAAATTTTAAGCA
GAATGTTTCCCTTCTAGAGAGGACTAGTTCATGCTTACTGGGCACCTAATTTTTGGGCTC
TTTATTGCTTCGCTGATAAGGTGCTTTCAACATTAGGTGAGATATTATAAATTAAGCTAT
TTTGTAATAAAATAACATTCTTTAAAAGCAAGAAAATTGCTTAAAATACCCATAAGTTCT
AAGAGTACTTTGACAAGTGGCGTCGTTCAAGTGACTTAATTTGATATTCTACCAGAGATA
AAGCCAATATACACAATAATGGCTATAATTATTATATCATTAGTAAAGATATTTTTTTAA
TCATTAACATCAATAAATAAAAGAATATTTTAATTTATTATACTCAAGCCTCTTTGGTAT
AAGATAGTCAGAAACCCAAAAGCATAAAACATCTTGCTTTATAGCAGCATCTAAATGTTT
ATATTTTACATGCTAGGCTATCATGTCCATGAGAAAGCAATATTACTCCCTCTAGGAATC
TATCAGTTATGGGCGATAGGAAAATAAAGTAGAAGCAGGTCAATAATTTCTATTTAATTT
CAAATTATCATATAAAGTTATCAACATTCCTTCCTTCTTTCCTTTACAGTTAAAAATTGA
AGTTAAAATTAAAGCTTTTGAAAAAAAGAAAATAATTTCTTTAGAAAATTTTATCATTTA
ATTGTTTTATAAAATAATTAAGTTAATTAAAATAATTTATTATTATTTATAAAAAATAAA
ATATTTATTTATCTTAATTAAAATTAATAGATTTGTATTGCTTTTCTCATTCGTAAGCGG
CGTAGGCTTACTTCCACTACTTCCAGAGCATTCTGGTAAGAAAATAATTTTAAATATTTT
TTTTTAATATTTCCTTTGTAATAAAAATAAATAATTTTGATTATTTAATAATGCAAATAT
ATTAAAAATTAAGAAACTGGACTTAAAATCATTGGACTATTCATTTATCATCTAGCATAT
TGGGCTTACCTAAGAAGAGATTGCTACAGAGAAGCTCAGAATTTAGATGATTACAAAAAA
TTTGGAATGAATTTTTTTGCAAAGTTTATTATATTCTCTGGGACAATAATTGCAATCTAT
GGAAATGTTCTTCATTACATTCTTTTTTTGAAATCAGAGTAACCATTTGTTTTTAGAATA
GAACTAATATTAATTCTAAATTAAATTTATAAACAGAAACAAGTTTGAATACCTACCTCT
TATGATCCATTCAGTATCTTAAATAATTTCTCTAAAATTATTTTATCCTTATCATTATTT
AATAAATAAAAAAAGGTTTATGGAGGTATTTTGAATTTGTACTTCATCATTGAAATGTAC
TTAGAACTATTTAGGTCTCAAAATTAAATTTCAATATAAGAAGTAAAATAATGA