Identifiers and Description

Gene Model Identifier

TTHERM_00127140

Standard Name

ALG8 (Predicted dolichyl-phosphate-glucose alpha-1,3-glucosyltransferase Alg8)

Aliases

PreTt09377 | 9.m00398 | 3699.m00107

Description

Glucosyl transferase, involved in N-linked glycosylation; adds glucose to the dolichol-linked oligosaccharide precursor prior to transfer to protein during lipid-linked oligosaccharide biosynthesis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00127140

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
SGDYOR067C2.0006398763136557e-76ALG8 Glucosyl transferase, inv
olved in N-linked glycosylatio
n; adds glucose to the dolicho
l-linked oligosaccharide precu
rsor prior to transfer to prot
ein during lipid-linked oligos
accharide biosynthesis; simila
r to Alg6p
WormBaseWBGene000074645.999140071902665e-66Probable dolichyl pyrophosphat
e Glc1Man9GlcNAc2 alpha-1,3-gl
ucosyltransferase status:Par
tially_confirmed UniProt:P52
887 protein_id:CAA91145.3
DictyBaseDDB_G02752612.000065869309806e-55alg8 on chromosome: 2 position
5068593 to 5070735
Tetrahymena borealisEI9_09652.15.0019039340728934e-39ALG6, ALG8 glycosyltransferase
(691 aa)
OxytrichaContig9150.0.g643.9997566980151843e-38ALG6, ALG8 glycosyltransferase
family
Stentor CoeruleusSteCoe_356210.0000000000006914400106940203

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00127140(coding)
ATGTTTGATTTAGTTGCTATTTGCTTTTTAATAAAGCTCTTGTTGGTATTTGCTTATCAT
AGTACTGACTTTGAAGTTCATCGAAACTGGCTCCGTATTACCTATAACTTGCCTTTAAGA
GAGTGGTATTATGATGATGTATCGATATGGACTCTTGACTACCCTCCTCTGTTTGCATAT
TTTGAATACATTTTGACATTTCCTGCTCGTTTCTTTGATATGAAGATGCTAGAAACCAAT
CAAGAATATAAAAGTGAAAATACTGTAATATATTAAAGAGCGACTGTGATGATTAGCGAT
CTTCTATTTTTATATGCAATCTGTAACTTCATAAAAGTCAGCTTTGGTAAAAATAAGTAA
AATTATGCTTATGCAGTCCTGTTCACTTTCCTTTAGTTCGGTTTCTTGCTTGTTGATAAT
ATCCATTTCCAATACAATTAATTCTTATAGGGTATTTTTATACTTTCCTTAACTAAATTT
ATCGAGGGAAGAAACATATTCGGAGGAATTCTCTTTGCATTGGTTCTTTGTTTCAAACAC
ATATTTCTCTATTCTGCACCTGCGATATTTTTCTTCTTACTAAAGTTTTATTGCTTTGAT
AATGGCAATAAATTAAACATTAGAAATTTCTCTAAGTTAGGGATGAGCGTCGTTACAGTA
TTCTTGATTTCGTTTCTCCCCTTTTTAAGCTTGGATGCAATCAAGTAAATTTTAAGCAGA
ATGTTTCCCTTCTAGAGAGGACTAGTTCATGCTTACTGGGCACCTAATTTTTGGGCTCTT
TATTGCTTCGCTGATAAGGTGCTTTCAACATTAGCAAGAAAATTGCTTAAAATACCCATA
AGTTCTAAGAGTACTTTGACAAGTGGCGTCGTTCAAGTGACTTAATTTGATATTCTACCA
GAGATAAAGCCAATATACACAATAATGGCTATAATTATTATATCATTACCTCTTTGGTAT
AAGATAGTCAGAAACCCAAAAGCATAAAACATCTTGCTTTATAGCAGCATCTAAATGTTT
ATATTTTACATGCTAGGCTATCATGTCCATGAGAAAGCAATATTACTCCCTCTAGGAATC
TATCAGTTATGGGCGATAGGAAAATAAAGTAGAAGCAGATTTGTATTGCTTTTCTCATTC
GTAAGCGGCGTAGGCTTACTTCCACTACTTCCAGAGCATTCTGAAACTGGACTTAAAATC
ATTGGACTATTCATTTATCATCTAGCATATTGGGCTTACCTAAGAAGAGATTGCTACAGA
GAAGCTCAGAATTTAGATGATTACAAAAAATTTGGAATGAATTTTTTTGCAAAGTTTATT
ATATTCTCTGGGACAATAATTGCAATCTATGGAAATGTTCTTCATTACATTCTTTTTTTG
AAATCAGAAAACAAGTTTGAATACCTACCTCTTATGATCCATTCAGTTTATGGAGGTATT
TTGAATTTGTACTTCATCATTGAAATGTACTTAGAACTATTTAGGTCTCAAAATTAAATT
TCAATATAAGAAGTAAAATAATGA


>TTHERM_00127140(protein)
MFDLVAICFLIKLLLVFAYHSTDFEVHRNWLRITYNLPLREWYYDDVSIWTLDYPPLFAY
FEYILTFPARFFDMKMLETNQEYKSENTVIYQRATVMISDLLFLYAICNFIKVSFGKNKQ
NYAYAVLFTFLQFGFLLVDNIHFQYNQFLQGIFILSLTKFIEGRNIFGGILFALVLCFKH
IFLYSAPAIFFFLLKFYCFDNGNKLNIRNFSKLGMSVVTVFLISFLPFLSLDAIKQILSR
MFPFQRGLVHAYWAPNFWALYCFADKVLSTLARKLLKIPISSKSTLTSGVVQVTQFDILP
EIKPIYTIMAIIIISLPLWYKIVRNPKAQNILLYSSIQMFIFYMLGYHVHEKAILLPLGI
YQLWAIGKQSRSRFVLLFSFVSGVGLLPLLPEHSETGLKIIGLFIYHLAYWAYLRRDCYR
EAQNLDDYKKFGMNFFAKFIIFSGTIIAIYGNVLHYILFLKSENKFEYLPLMIHSVYGGI
LNLYFIIEMYLELFRSQNQISIQEVKQ


>TTHERM_00127140(gene)
ATGTTTGATTTAGTTGCTATTTGCTTTTTAATAAAGCTCTTGTTGGTATTTGCTTAGTAA
AAATTTGACCTTTAGATTTTTTTAAACAAACAATTAAACCCTCAACATAAATTTAACGCT
TATCGAGATTCATAAACCCTATTTATAGATAAACTCCAACGCATAAAAACTACTCTAAAT
TAACTTCATTTTTAATTATAGTCATAGTACTGACTTTGAAGTTCATCGAAACTGGCTCCG
TATTACCTATAACTTGCCTTTAAGAGAGTGGTATTATGATGTAATTAGATTAATTTCAAA
ATTATGCAACAAATCGATTATTTTCTACAAAATAACATAAAAATTAAAAGGATGTATCGA
TATGGACTCTTGACTACCCTCCTCTGTTTGCATATTTTGAATACATTTTGACATTTCCTG
CTCGTTTCTTTGATATGAAGATGCTAGAAGTACTTAGAAGTTTAATATCTTTTCTATGTA
TTTGATTAATATCTTAATTTAATACTGAATAGACCAATCAAGAATATAAAAGTGAAAATA
CTGTAATATATTAAAGAGCGACTGTGATGATTAGCGATCTTCTATTTTTATATGCAATCT
GTAACTTCATAAAAGTCAGCTTTGGTAAAAATAAGTAAAATTATGCTTATGCAGTCCTGT
TCACTTTCCTTTAGTTCGGTTTCTTGCTTGTTGATAATATCCATTTCCAATACAATTAAT
TCTTATAGGGTATTTTTATACTTTCCTTAACTAAATTTATCGAGGTAAATTAACTAAAAA
TAATTACTAACTGTATTACTCAATTTGAAGACATTTATTCCGCTCTTAATACATAAGCTA
ATTCAAAACGAATGAAAAGTACATTAAGGGGCTTTATAAAATTTAATCTTATTAGTGTTA
GGCTTAATTTACTTTATTATTATTAAAATTCAAAAATAACACTTATACTCAATTTATTTA
AGCTAATTTCATCAAAAATAAAGGGAAGAAACATATTCGGAGGAATTCTCTTTGCATTGG
TTCTTTGTTTCAAACACATATTTCTCTATTCTGTAACAAAAAGAAACGAAAAGTTAATTA
AAAAATTGAATAAAACTTAATTAAAATTAGGCACCTGCGATATTTTTCTTCTTACTAAAG
TTTTATTGCTTTGATAATGGCAATAAATTAAACATTAGAAATTTCTCTAAGTTAGGGATG
AGCGTCGTTACAGTATTCTTGATTTCGTTTCTCCCCTTTTTAAGCTTGGGTAAAAATTAA
ATTTCATAATTAGCTACTAGCAAAATATATATTTATTTTTATAAATTAGATCCTAATTCT
TTAAATAAATTTTAAAAAGAGAATTAGTTGCTACTTTAATTAATTTTTTGTCAATTATAA
ATTGTTTAGATGCAATCAAGTAAATTTTAAGCAGAATGTTTCCCTTCTAGAGAGGACTAG
TTCATGCTTACTGGGCACCTAATTTTTGGGCTCTTTATTGCTTCGCTGATAAGGTGCTTT
CAACATTAGGTGAGATATTATAAATTAAGCTATTTTGTAATAAAATAACATTCTTTAAAA
GCAAGAAAATTGCTTAAAATACCCATAAGTTCTAAGAGTACTTTGACAAGTGGCGTCGTT
CAAGTGACTTAATTTGATATTCTACCAGAGATAAAGCCAATATACACAATAATGGCTATA
ATTATTATATCATTAGTAAAGATATTTTTTTAATCATTAACATCAATAAATAAAAGAATA
TTTTAATTTATTATACTCAAGCCTCTTTGGTATAAGATAGTCAGAAACCCAAAAGCATAA
AACATCTTGCTTTATAGCAGCATCTAAATGTTTATATTTTACATGCTAGGCTATCATGTC
CATGAGAAAGCAATATTACTCCCTCTAGGAATCTATCAGTTATGGGCGATAGGAAAATAA
AGTAGAAGCAGGTCAATAATTTCTATTTAATTTCAAATTATCATATAAAGTTATCAACAT
TCCTTCCTTCTTTCCTTTACAGTTAAAAATTGAAGTTAAAATTAAAGCTTTTGAAAAAAA
AGAAAATAATTTCTTTAGAAAATTTTATCATTTAATTGTTTTATAAAATAATTAAGTTAA
TTAAAATAATTTATTATTATTTATAAAAAATAAAATATTTATTTATCTTAATTAAAATTA
ATAGATTTGTATTGCTTTTCTCATTCGTAAGCGGCGTAGGCTTACTTCCACTACTTCCAG
AGCATTCTGGTAAGAAAATAATTTTAAATATTTTTTTTTAATATTTCCTTTGTAATAAAA
ATAAATAATTTTGATTATTTAATAATGCAAATATATTAAAAATTAAGAAACTGGACTTAA
AATCATTGGACTATTCATTTATCATCTAGCATATTGGGCTTACCTAAGAAGAGATTGCTA
CAGAGAAGCTCAGAATTTAGATGATTACAAAAAATTTGGAATGAATTTTTTTGCAAAGTT
TATTATATTCTCTGGGACAATAATTGCAATCTATGGAAATGTTCTTCATTACATTCTTTT
TTTGAAATCAGAGTAACCATTTGTTTTTAGAATAGAACTAATATTAATTCTAAATTAAAT
TTATAAACAGAAACAAGTTTGAATACCTACCTCTTATGATCCATTCAGTATCTTAAATAA
TTTCTCTAAAATTATTTTATCCTTATCATTATTTAATAAATAAAAAAAGGTTTATGGAGG
TATTTTGAATTTGTACTTCATCATTGAAATGTACTTAGAACTATTTAGGTCTCAAAATTA
AATTTCAATATAAGAAGTAAAATAATGA