Identifiers and Description

Gene Model Identifier

TTHERM_00070990

Standard Name

ALG7 (Predicted UDP-GlcNAc:dolichol phosphate N-acetylglucosamine-1-phosphate transferase Alg7)

Aliases

PreTt13289 | 4.m00688 | 3707.m00323

Description

UDP-N-acetyl-glucosamine-1-P transferase, transfers Glc-Nac-P from UDP-GlcNac to Dol-P in the ER in the first step of the dolichol pathway of protein asparagine-linked glycosylation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00953 ) glycosyl transferase, group 4 family
  • ( TIGR00445 ) phospho-N-acetylmuramoyl-pentapeptide-transferase
  • ( TIGR02380 ) undecaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphatetransferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00070990

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02206.19.997093137033517e-262glycosyl transferase (382 aa)
DictyBaseDDB_G02907519.996050283847121e-108alg7 on chromosome: 5 position
4491192 to 4492842
OxytrichaContig20717.0.g194.001242549923285e-107Glycosyl transferase family 4
WormBaseWBGene000133622.000341663036036e-86status:Partially_confirmed U
niProt:Q9U1Z2 protein_id:CAB
60399.2
SGDYBR243C6.997568408582301e-83ALG7 UDP-N-acetyl-glucosamine-
1-P transferase, transfers Glc
-Nac-P from UDP-GlcNac to Dol-
P in the ER in the first step
of the dolichol pathway of pro
tein asparagine-linked glycosy
lation; inhibited by tunicamyc
in
Stentor CoeruleusSteCoe_207071.5400882849875202e-51

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00070990(coding)
ATGCAGCTTTAAGATGTACTAATCCACTCAAGCGTACTACTCGCCACTAGTAGCACTGCT
TACTATTACTATTATAAGTTATAGTCATTAGCATTTTTGCTTTATCTAGTAGTTTCATCT
ACAACTTATTTAGCAGTATTTTACATGATTCCTAAAATAAAAAAATTTACTCTTAATGCT
GGTTTGTATGGAAAAGATATTAATAAAAAAGGTACACCAGAAGGTGAGTTGCAAATACCT
GAAACGCTAGGAATAGTACCTGCTACTATATTTATCATTTTTAATATGGTAGGTGTTTTA
TATTCATATAAATAGCACTCTACAAGTCATATTGCATTTGAGCATTGTGCAGGAATGCTA
TCTATTTGTTTTATTATTTTCCTAGGATTTTGCGATGATGTTTTTGATTTACCCTGGCGC
TATAAAATTCTTCTGCCTAATTTAGCAAGTCTACCAATCCTTGTAGCATATGAAGGAGTC
ACTCATGTTGTTTTACCTATATTTTTGCGTCCATATTTAGGAAATTATGTCAATTTAGGT
ATTTTATATTACCTTTATATGATGGCTGTTGTTACTTTTTGCACTAATTCTATTAATATT
TATGCTGGCATTAATGGGTTAGAAGTTACCTAAAGTATAATTATAGCCTGTAGTATTTTA
CTTTACAACCTAACTGAACTGTGGCTTGGTGAATAATAGACATTCTCACACACTATTAGC
ATTTAAATAATTTTACCTTTCATCTTTTGTACTCTTGGTTTATACTACTATAATAAATAC
CCTTCTTAAGTATTTGTTGGTGACACATTCTGCTACTGGAGTGGAATGGTCTTTGCCACA
GTTGGAATTCTGGGTCACTTTTCTAAGACACTTTTATTATTTTTCATACCTTAAATTTTA
AATTTCGTTTATTCCTTTCCTTAGTTGATGAAAATAATACCTTGTCCTCGTCATAGACTT
CCTTATTACAATGTAGAAACTAAAAAATTGGAAAAAGTAAAAACCAATTTAAATCTAATT
AATCTTTATTTATGGATTCGTGGCCCTCTCTCTGAAAAAGATCTTTGCAAAGAATTAGTT
ATTTTATAAATTTCTTGCTCTATTTTAGGTTTCTTTATTAGATACTATGGAGCTCATTTG
ATGTTCTGA


>TTHERM_00070990(protein)
MQLQDVLIHSSVLLATSSTAYYYYYKLQSLAFLLYLVVSSTTYLAVFYMIPKIKKFTLNA
GLYGKDINKKGTPEGELQIPETLGIVPATIFIIFNMVGVLYSYKQHSTSHIAFEHCAGML
SICFIIFLGFCDDVFDLPWRYKILLPNLASLPILVAYEGVTHVVLPIFLRPYLGNYVNLG
ILYYLYMMAVVTFCTNSINIYAGINGLEVTQSIIIACSILLYNLTELWLGEQQTFSHTIS
IQIILPFIFCTLGLYYYNKYPSQVFVGDTFCYWSGMVFATVGILGHFSKTLLLFFIPQIL
NFVYSFPQLMKIIPCPRHRLPYYNVETKKLEKVKTNLNLINLYLWIRGPLSEKDLCKELV
ILQISCSILGFFIRYYGAHLMF


>TTHERM_00070990(gene)
ATGCAGCTTTAAGATGTACTAATCCACTCAAGCGTACTACTCGCCACTAGTAGCACTGCT
TACTATTACTATTATAAGTTATAGTCATTAGCATTTTTGCTTTATCTAGTAGTTTCATCT
ACAACTTATTTAGCAGTATTTTACATGATTCCTAAAATAAAAAAATTTACTCTTAATGCT
GGTTTGTATGGAAAAGATATTAATAAAAAAGGTACACCAGAAGGTGAGTTGCAAATACCT
GAAACGCTAGGAATAGTACCTGCTACTATATTTATCATTTTTAATATGGTAGGTGTTTTA
TATTCATATAAATAGCACTCTACAAGTCATATTGCATTTGAGCATTGTGCAGGAATGCTA
TCTATTTGTTTTATTATTTTCCTAGGATTTTGCGATGATGTTTTTGATTTACCCTGGCGC
TATAAAATTCTTCTGCCTAATTTAGCAAGTCTACCAATCCTTGTAGCATATGAAGGAGTC
ACTCATGTTGTTTTACCTATATTTTTGCGTCCATATTTAGGAAATTATGTCAATTTAGGT
AAATTTTTAGCATAAATAAGTTTAAACATAGAAAAAATATTTGAATAAAAGATTTAGATA
AGTTAAATAAATTTTTTTCAAGATAAATGAATTTACTTTTTAAAAAATATAAAATCTATT
TTAAAATTGAAAATTTAGAATTTTGTATTTCGTCAATCAAGAGAAAAATTAAATTTAAAT
TAAGTTTATTGAAACAAGAGTTAAATAAATTATAAATAACATTAAATTAAGTACTATTTC
TATATAAAAATAGGTATTTTATATTACCTTTATATGATGGCTGTTGTTACTTTTTGCACT
AATTCTATTAATATTTATGCTGGCATTAATGGGTTAGAAGTTACCTAAAGTATAATTATA
GCCTGTAGTATTTTACTTTACAACCTAACTGAACTGTGGCTTGGTGAATAATAGACATTC
TCACACACTATTAGCATTTAAATAATTTTACCTTTCATCTTTTGTACTCTTGGTTTATAC
TACTATAATAAATACCCTTCTTAAGTATTTGTTGGTGACACATTCTGCTACTGGAGTGGA
ATGGTCTTTGCCACAGTTGGAATTCTGGGTCACTTTTCTAAGACACTTTTATTATTTTTC
ATACCTTAAATTTTAAATTTCGTTTATTCCTTTCCTTAGTTGATGAAAATAATACCTTGT
CCTCGTCATAGACTTCCTTATTACAATGTAGAAACTAAAAAATTGGAAAAAGTAAAAACC
AATTTAAATCTAATTAATCTTTATTTATGGATTCGTGGCCCTCTCTCTGAAAAAGATCTT
TGCAAAGAATTAGTTATTTTATAAATTTCTTGCTCTATTTTAGGTTTCTTTATTAGATAC
TATGGAGCTCATTTGATGTTCTGA