Identifiers and Description

Gene Model Identifier

TTHERM_00500810

Standard Name

ALG6 (Asparagine-Linked Glycosylation 6)

Aliases

PreTt08025 | 63.m00203 | 3716.m00056

Description

Predicted dolichyl-phosphate-glucose alpha-1,3-glucosyltransferase; involved in transfer of oligosaccharides from dolichyl pyrophosphate to asparagine residues of proteins during N-linked protein glycosylation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

  • transferase activity, transferring hexosyl groups (IEA) | GO:0016758

Domains

  • ( PF03155 ) ALG6, ALG8 glycosyltransferase family
  • ( TIGR02358 ) probable hydroxymethylpyrimidine transporter CytX

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00500810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09652.19.997093137033517e-262ALG6, ALG8 glycosyltransferase
(691 aa)
OxytrichaContig22850.0.g169.998074580622396e-81ALG6, ALG8 glycosyltransferase
family
DictyBaseDDB_G02838418.001565848068406e-78alg6 on chromosome: 4 position
1202486 to 1204316
WormBaseWBGene000074354.998071612500574e-77Probable dolichyl pyrophosphat
e Man9GlcNAc2 alpha-1,3-glucos
yltransferase status:Partial
ly_confirmed UniProt:Q09226
protein_id:CAA86666.1
SGDYOR002W1.999469658314961e-75ALG6 Alpha 1,3 glucosyltransfe
rase, involved in transfer of
oligosaccharides from dolichyl
pyrophosphate to asparagine r
esidues of proteins during N-l
inked protein glycosylation; m
utations in human ortholog are
associated with disease
Stentor CoeruleusSteCoe_356211.6458114310822737e-38

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00500810(coding)
ATGTCATAATAAGAAAGTGGAGAAACGTAATCTCAAAAAATAACAAATACGCGTTTAATG
AGAGAACGCAAAGAAATAGACACCGTTTTATAAGAGTATGATGTACAATGGAAAGAATCT
TAAAAAGGAGTAGAAGTCTAGTTTAGCTTCTAAATAAATTCTGAAAACAAGAAAGATAGC
GTCGCTCATGCAGAAATAAAATTAGAATAAAGTTACCCATTTTCATAGCCTCTAATAAAG
TTCAATCTTACTCCTGGATAACTTGCTCTTTTTAACCATGACAGCTATAAAGAAATTGAT
TATTATACTAACAAAACTTATACACCTAAGATGACAGTCGCTGATATCATTAAATTGATT
GCTGAATATGGAAAGAAAAATATATAAATAGGAGATAAGAGTAAAAAAGAAACAATTTTT
AGTTTGGTCCATACTCTCTATTCAATTTTAGGATCAACTTCTACAATTATTTTTATAATT
CTATTTGCATCTTTCATTAGAATTTTAGCAGGAATTGGACCATACTCAGGATACAAAGAT
GCTCCCACATATGGTGACTATGAAGCTTAGAGACACTGGATGGAATTAACTCTTCATACT
CCTCCAAGCTAATGGTATGTTGAAACATTAAACAATGATTTGACTTATTGGAGAATAGAT
TATCCTCCTCTCAGTGCATATGTCAGCTACATTTTTGGATATATCAGTCATTAATTTGAC
CCAAAATCTGTAGAATTATATCACAGTAGAGGTTATGAAGAACCCAACCATAAAATCTAC
ATGAGAATGACAGTCTTGATTAGTGACATATTATTTTTCTTCACAAGTTTATACTATGTT
ACTAAAATTGAATTCAATAAGTATAGCTTTACTCTTCGCTCTCTTTTTTACCTTCTAGCC
TTGCTTTGCCCTCCATTCATTCTTATTGATCATGCTCACTTCCAATATAATAGCTTCATG
CATGGGCTTGTATTGTGGTCTGTTTATTTCTGCTCCTAAGGAAGTGTAGTGATCGGAGGA
ATATTATTTACCCTTGCTCTTAATTTCAAACAGATGGGTTTGTATTATTCCTTAGGTTTC
TTTTTTTATATTCTCGGATATCTAGCTGTAGATTCTGGTTTTAGAAGCATTAAAACAAAC
AAATACAATTTTGGAGCTTCTTTATTTTTTATCTTACGAATTGCTTTAGTAGGATTTGGA
GTTATTGCTACTTTTGTATTAATGATACTTCCATGGATAACTGATAAGTACTTGCTCACT
TCTCTGGTCTCTGCTATATTCCCTGTTCATAGAGGGCTCTATTAATTAAAAGTAGCAAAC
TTTTGGTGTTTTTCTAATATTTTTATTAAATGGACTCAGATATTTGATCAAAAAGTGATA
ATTCTAATGTCAATAGCCTTCACATTGGTTGCTTGTCTCCCTAGCATTTATGTTGTATTT
TTGAGACCAAAATATAAATATTTAAAATTAGCTCTTTTCAATATTTCTATGAGTTTCTTT
TTCTTCTCATATCATGTACATGAAAAGACTATTTTGATTCCATTAGTCTTATATGTTTTG
TGCATCAGATATATGAATATCTATTATTTAGATTTTGTAACAATTAGCTGCTTAACTCTT
TATCCCTTGCTAAGAGAAGATAAATAAACTCTCTGCTGGTTTGTTTTAACAATAGTTCAC
CACTTTTTTGTTAGAAAAACTTTGAAGTACTTAGAAATATAAGGAGTTATAAAAAAGAAC
TTAACTGATTAGTGCACACTTATATCAGACAGCAAAGTTACTGATTAAACAACATAGAAA
AAAATCTTGGAATAAGAAAAGGATATTCCTTTAATAGTTAAATTGATATCTTTGACTGAT
TTATTTTACAAATCTATTTTCCGTAAAGCAATCTATATTTTATCTATCATAGCAATTATA
GCTGAAAAATATGTTAAGCCTCCTACCAATTACCCATATCTTTTTTCTCTGATCTATGCT
GTATTAGGGTTTGGTCTATTTGCTTATGTCTTCATTTAAACTAATTTGTTAATGCTACAC
TCTTACTAGCGTAGTTAAAAAAAGAAATAAAAATTAGATTGA


>TTHERM_00500810(protein)
MSQQESGETQSQKITNTRLMRERKEIDTVLQEYDVQWKESQKGVEVQFSFQINSENKKDS
VAHAEIKLEQSYPFSQPLIKFNLTPGQLALFNHDSYKEIDYYTNKTYTPKMTVADIIKLI
AEYGKKNIQIGDKSKKETIFSLVHTLYSILGSTSTIIFIILFASFIRILAGIGPYSGYKD
APTYGDYEAQRHWMELTLHTPPSQWYVETLNNDLTYWRIDYPPLSAYVSYIFGYISHQFD
PKSVELYHSRGYEEPNHKIYMRMTVLISDILFFFTSLYYVTKIEFNKYSFTLRSLFYLLA
LLCPPFILIDHAHFQYNSFMHGLVLWSVYFCSQGSVVIGGILFTLALNFKQMGLYYSLGF
FFYILGYLAVDSGFRSIKTNKYNFGASLFFILRIALVGFGVIATFVLMILPWITDKYLLT
SLVSAIFPVHRGLYQLKVANFWCFSNIFIKWTQIFDQKVIILMSIAFTLVACLPSIYVVF
LRPKYKYLKLALFNISMSFFFFSYHVHEKTILIPLVLYVLCIRYMNIYYLDFVTISCLTL
YPLLREDKQTLCWFVLTIVHHFFVRKTLKYLEIQGVIKKNLTDQCTLISDSKVTDQTTQK
KILEQEKDIPLIVKLISLTDLFYKSIFRKAIYILSIIAIIAEKYVKPPTNYPYLFSLIYA
VLGFGLFAYVFIQTNLLMLHSYQRSQKKKQKLD


>TTHERM_00500810(gene)
ATGTCATAATAAGAAAGTGGAGAAACGTAATCTCAAAAAATAACAAATACGCGTTTAATG
AGAGGTAACTAAAAACTATTTAATAGCTATCTTAGTTTTATTAATTTTTATAAGAACGCA
AAGAAATAGACACCGTTTTATAAGAGTATGATGTACAATGGAAAGAATCTTAAAAAGGAG
TAGAAGTCTAGGTAATATTATGCTTAAAAAATAAATATTAACAAAAAATAAATAAAATCT
AACAACAGTTTAGCTTCTAAATAAATTCTGAAAACAAGAAAGATAGCGTCGCTCATGCAG
AAATAAAATTAGAATAAAGTTACCCATTTTCATAGCCTCTAATAAAGTTCAATCTTACTG
TAATTGCAGCATTAATTTTGTTTTTGAAAAAAATTTAAAATTAATTTATGAAAAGCCTGG
ATAACTTGCTCTTTTTAACCATGACAGCTATAAAGAAATTGATTATTATACTAACAAAAC
TTATACACCTAAGATGACAGTCGCTGATATCATTAAATTGTAAAATTATTATCAATAAGA
CTTTTATTTAGATTAAATATATTTGAATAGGATTGCTGAATATGGAAAGAAAAATATATA
AATAGGAGATAAGAGTAAAAAAGAAACAATTTTTAGTTTGGTCCATACTCTCTATTCAAT
TTTAGGATCAACTTCTACAATTATTTTTATAATTCTATTTGCATCTTTCATTAGAATTTT
AGCAGGAATTGGACCATACTCAGGATACAAAGATGGTAACAACAAAGAATTTTTAATAAG
ACTTATTTATCTGAGAGAAATTTAATTTTAAGATCAATTAATTATGAATAAGCTCCCACA
TATGGTGACTATGAAGCTTAGAGACACTGGATGGAATTAACTCTTCATACTCCTCCAAGC
TAATGGTATGTTGAAACATTAAACAATGATTTGACTTATTGGAGAATAGATTATCCTCCT
CTCAGTGCATATGTCAGCTACATTTTTGGATATATCAGTCATTAATTTGACCCAAAATCT
GTAGAATTATATCACAGTAGAGGTTATGAAGAACCCAACCATAAAGTATAAAAGAATACA
TTTTAAAATAAATTTAATATAATTATCTTAAATAATATTTTTTAGATCTACATGAGAATG
ACAGTCTTGATTAGTGACATATTATTTTTCTTCACAAGTTTATACTATGTTACTAAAATT
GAATTCAATAAGTATAGCTTTACTCTTCGCTCTCTTTTTTACCTTCTAGCCTTGCTTTGC
CCTCCATTCATTCTTATTGATCATGCTCACTTCCAATATAATAGCTTCATGCATGGGCTT
GTATTGTGGTCTGTTTATTTCTGCTCCTAAGGAAGTGTAGTGATCGGAGGAATATTATTT
ACCCTTGCTCTTAATTTCAAACAGATGGGTTTGTATTATTCCTTAGGTTTCTTTTTTTAT
ATTCTCGGATATCTAGCTGTAGATTCTGGTTTTAGAAGCATTAAAACAAACAAAGTAATT
TTATTTTTTTAATGCAAAATAAGTTCTATTTTAATCATTTTTATATAAAAGTACAATTTT
GGAGCTTCTTTATTTTTTATCTTACGAATTGCTTTAGTAGGATTTGGAGTTATTGCTACT
TTTGTATTAATGATACTTCCATGGATAACTGATAAGTACTTGCTCACTTCTCTGGTCTCT
GCTATATTCCCTGTTCATAGAGGGCTCTATTAATTAAAAGTAAATATTTAAATTTGAAAG
GTTAATTCCTAATTTGATATTTAAAAATATTAATCTAAGGTAGCAAACTTTTGGTGTTTT
TCTAATATTTTTATTAAATGGACTCAGATATTTGATCAAAAAGTGATAATTCTAATGTCA
ATAGCCTTCACATTGGTTGCTTGTCTCCCTAGCATTTATGTTGTATTTTTGAGACCAAAA
TATAAATATTTAAAATTAGCTCTTTTCAATATTTCTATGAGTTTCTTTTTCTTCTCATAT
CATGTACATGAAAAGACTATTTTGATTCCATTAGTCTTATATGTTTTGTGCATCAGATAT
ATGAATATCTATTATTTAGATTTTGTAACAATTAGCTGCTTAACTCTTTATCCCTTGCTA
AGAGAAGATAAATAAACTCTCTGCTGGTTTGTTTTAACAATAGGTAAATTACAAATTAAC
TAAGAAACTTATCAAACATTTATTTATTATTTATTTATTTAGTTCACCACTTTTTTGTTA
GAAAAACTTTGAAGTACTTAGAAATATAAGGAGTTATAAAAAAGAACTTAACTGATTAGT
GCACACTTATATCAGACAGCAAAGTTACTGATTAAACAACATAGAAAAAAATCTTGGAAT
AAGAAAAGGATATTCCTTTAATAGTTAAATTGATATCTTTGACTGATTTATTTTACAAAT
CTATTTTCCGTAAAGCAATCTATATTTTATCTATCATAGCAATTATAGCTGAAAAATATG
TTAAGCCTCCTACCAATTACCCATATCTTTTTTCTCTGATCTATGCTGTATTAGGGTTTG
GTCTATTTGCTTATGTCTTCATTTAAACTAATTTGTTAATGCTACACTCTTACTAGCGTA
GTTAAAAAAAGAAATAAAAATTAGATTGA