Identifiers and Description

Gene Model Identifier

TTHERM_00047110

Standard Name

ALG5 (Asparagine-Linked Glycosylation )

Aliases

PreTt11190 | 3.m01715 | 3824.m02949

Description

UDP-glucose:dolichyl-phosphate glucosyltransferase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 17.5%

TetraMine Data

TTHERM_00047110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01747.19.997093137033517e-262glycosyl transferase, group 2
family protein (320 aa)
DictyBaseDDB_G02883211.0000521619018958e-77dgtA on chromosome: 5 position
1385100 to 1386562
OxytrichaContig14645.0.g351.0004460510701209e-64Glycosyl transferase family 2
WormBaseWBGene000192763.0011931572567413e-53status:Partially_confirmed U
niProt:Q8WSL9 protein_id:CCD
68664.1
SGDYPL227C1.0004249259458435e-52ALG5 UDP-glucose:dolichyl-phos
phate glucosyltransferase, inv
olved in asparagine-linked gly
cosylation in the endoplasmic
reticulum
Stentor CoeruleusSteCoe_362421.462486227251231e-31

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00047110(coding)
ATGTTTACATCAATAGTTTGGGTAGCTTTATTTGTTGGAATATTTACCTTATTAAGGTTC
ATCTTCAGTCCATATTTTACATGGAAAAAACAAATGAAAAATCGCAGTAGCATTAAAAAT
TCTCGCATTCACACTAAAAATAAAACATACACATTCGAAGAATACAGAAAGCTAAATAAT
GACTACTTCTTTTCAATGGTCATTCCTGCTTACAATGAAGAAGCACGTATAGCAAAAATG
CTTAAAGAGCATATAAAATATTTTGAAAACTACTCAGGCTTCTAAGGCAAGAAATATGAA
GTAATTATAGTTAATGATTGCTCAAAAGACAAGACTTCAGAGATAGCAAAATCCTTCTTT
ACATTTGAAGGCAAAGATGTGGATTTGAAGGTAGTTGATTACTAGTAAAATTTAGGAAAG
GGTGGTGCAGTTAGAACAGGTATGCTTTTATCTTCAGGCTAATACACTTTAATGGTGGAT
GCTGATGGTGCAACAGACATTAATTGTTTTGATAAAGTTTTTAAGAAGCTTTTATAGATC
GAAAAGAATGAATTAGGTATTGCAGTTGGATCCCGTTCCCATCTTGACAAGGAGTCTGTA
GCTAAAAGAAAGTTTTACAGAAAAATTTTAGCTTTTGTTTCAAACTTTATTGTATAAGTC
ATTTGTGGAGTTAAGCTAAATGATACCTAATGTGGATTCAAGTTATTCACTAGAAAGACA
ACTGAAATCATTTTTGGTGTATAACATTTAGAAAGATGGGCTTTTGATGTAGAAATTTTA
ATGATTGGTAACCACTATAAAATGCCTATTGCTGAAGTTCCAGTTAACTGGGAAGATGTT
GATGGTTCACATTTGAATGTGATTGAGGCTTCAGTTACAATGGCCAGAGATTTCTTAATG
GTTAGACTTCTTTATTTATTAGGTGTTTGGAAATACAATGATTCAATTTATAAGAGTTGA


>TTHERM_00047110(protein)
MFTSIVWVALFVGIFTLLRFIFSPYFTWKKQMKNRSSIKNSRIHTKNKTYTFEEYRKLNN
DYFFSMVIPAYNEEARIAKMLKEHIKYFENYSGFQGKKYEVIIVNDCSKDKTSEIAKSFF
TFEGKDVDLKVVDYQQNLGKGGAVRTGMLLSSGQYTLMVDADGATDINCFDKVFKKLLQI
EKNELGIAVGSRSHLDKESVAKRKFYRKILAFVSNFIVQVICGVKLNDTQCGFKLFTRKT
TEIIFGVQHLERWAFDVEILMIGNHYKMPIAEVPVNWEDVDGSHLNVIEASVTMARDFLM
VRLLYLLGVWKYNDSIYKS


>TTHERM_00047110(gene)
ATGTTTACATCAATAGTTTGGGTAGCTTTATTTGTTGGAATAGTATAAATTTAAATTTAG
AATAGTCTGTTAATTCAAAATAATTGTTTGTTTAAAATAGTTTACCTTATTAAGGTTCAT
CTTCAGTCCATATTTTACATGGAAAAAACAAATGAAAAATCGCAGTAGCATTAAGTAAGT
GATAAATAATACATTTAGTGAAATGATAGCAAATATAAACTTTACATGACTTAGCATGAT
TAATAAAGATTATATGCTGCTTGCAAGCAAAACTAATTACTATTTATTTAATTTGCTTTT
TTAATATAAAATAGAAATTCTCGCATTCACACTAAAAATAAAACATACACATTCGAAGAA
TACAGAAAGCTAAATAATGACTACTTCTTTTCAATGGTCATTCCTGCTTACAATGAAGAA
GCACGTATAGCAAAAATGCTTAAAGAGCATATAAAAGTAAGCATAATTTTTTTTATATTC
ATAAATAAAAGTTTGTATAAAATAATATAGTATTTTGAAAACTACTCAGGCTTCTAAGGC
AAGAAATATGAAGTAATTATAGTTAATGATTGCTCAAAAGACAAGACGTAAATAAATAAA
TAAGCAAGTTTAAGCTATTTTTTAATTATTCTATTTAATAATGACTTACAGTTCAGAGAT
AGCAAAATCCTTCTTTACATTTGAAGGCAAAGATGTGGATTTGAAGGTAGTTGATTACTA
GTAAAATTTAGGAAAGGGTGGTGCAGTTAGAACAGTAATTTTTCTATTAAAATAACCAAA
GAATTTAATATAATTTTATATACAATTGTGAATTAGGGTATGCTTTTATCTTCAGGCTAA
TACACTTTAATGGTGGATGCTGATGGTGCAACAGACATTAATTGTTTTGATAAAGTTTTT
AAGAAGGTAGATAAAATTATAGAATAAATAAATAAACTTATTATTTTCTATTAATAATAA
CTTAATTAAATATGATAGCTTTTATAGATCGAAAAGAATGAATTAGGTATTGCAGTTGGA
TCCCGTTCCCATCTTGACAAGGAGTCTGTAGCTAAAAGAAAGTTTTACAGAAAAATTTTA
GCTTTTGTTTCAAACTTTATTGTATAAGTCATTTGTGGAGTTAAGCTAAATGTAAGCTTT
TTAAAGAATTTTAAAAGAATTATCTCATCAATTTTAAAAATAAAAGGATACCTAATGTGG
ATTCAAGTTATTCACTAGAAAGACAACTGAAATCATTTTTGGTGTATAACATTTAGAAAG
ATGGGCTTTTGATGTAGAAATTTTAATGATTGGTAACCACTATAAAATGCCTATTGCTGA
AGTTCCAGTTAACTGGGAAGATGTTGATGGTAAAGCTATATGAATAGTTAATTAAAATAT
CTTATCAAAAATTTATTTAATAGGTTCACATTTGAATGTGATTGAGGCTTCAGTTACAAT
GGCCAGAGATTTCTTAATGGTTAGACTTCTTTATTTATTAGGTGTTTGGAAATACAATGA
TTCAATTTATAAGAGTTGA