Identifiers and Description

Gene Model Identifier

TTHERM_00335960

Standard Name

ALG2 (Predicted alpha-1,3-mannosyltransferase)

Aliases

PreTt06039 | 34.m00276 | 3689.m00073

Description

Presumed early mannosyltransferase involved in the N-linked glycosylation pathway

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR02149 ) glycogen synthase, Corynebacterium family
  • ( PF00534 ) glycosyl transferase, group 1 family
  • ( TIGR03088 ) sugar transferase, PEP-CTERM/EpsH1 system associated

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.1%

TetraMine Data

TTHERM_00335960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16093.19.997093137033517e-262glycosyl transferase, group 1
family protein (771 aa)
DictyBaseDDB_G02727304.9988663627895604e-120alg2 on chromosome: 2 position
2218228 to 2219580
OxytrichaContig4487.0.g269.996261361959507e-120Glycosyl transferases group 1
SGDYGL065C1.0000943968537097e-101ALG2 Mannosyltransferase that
catalyzes two consecutive step
s in the N-linked glycosylatio
n pathway; alg2 mutants exhibi
t temperature-sensitive growth
and abnormal accumulation of
the lipid-linked oligosacchari
de Man2GlcNAc2-PP-Dol
WormBaseWBGene000172825.002432061182517e-99status:Confirmed UniProt:Q19
265 protein_id:CCD68755.1
Stentor CoeruleusSteCoe_304492.820770088460135e-53

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00335960(coding)
ATGTCAGAAAGTAAATCTTAGTTGAGAATAGGATTTATTCATCCTGATTTAGGTATAGGA
GGAGCTGAATAATTAATAGTTAATATGGCTGTTGCTCTTAAAAAGTAAGGGCATAATGTA
ATTATCTACACTCCATATCATGATCCTAAGCACTGCTTTTAAGCAACAATAGATGGAACT
ATACCCGTCGAAGTGAGAGGAGCCATAGTACCTTAAACAATATTTGGTAAACTTTGGGCT
CTCTGTGCTACTATTAGAGTCATTTTTTGTACTTTATATTTGATTTGCTTTGGGTTTAAA
TTTGATGTAGTCATTGTAGATTAGGTAAGTCCTGCAGTTCCTCTACTTCGTCTTTTCAAT
AGAAAATGCCTTTTTTACTGTCATTATCCTGACAAGTTGCTCTGTGTTGAAAGAAGATCT
ATTTTGAAAAAGATATATAGATTTTTTTTAGACTACATAGAAGAATTCAGCTTATTATTT
GCTAACAAAATTTTAGTTAATAGTAATTTTACACGTGAAGTTTACTAGAGATCATTCAAA
TATCTTAGTAAATATAATAATCCTGAAATATTATATCCTGCAATAGACTTTTCAAGCTTC
GATGATACTATAAAATAATCAGCACCAGTAGATTCAAAGGCAAGCCCATTTTTCTTGTCA
CTCAACCGTTATGAACGTAAGAAAAATATTAACTTAGCTATTTAAGCATTTGCATAATTT
GTCAAGGAGTCAGCTTCTAATAATCAATTTAAGCTTATAATTGCTGGAGGATATGATGAA
AGAATAGCTGAAAATGTTGAACACCATAAGGAGTTATTGTCTCTTGCTAAAGAATTAAAT
GTGGAAGACAAAGTTGTATTTAAATTTAGTATCTCAAACAAAGAAAGAACTTAATTATTA
TAAACTGCTCAAGCAGTATTATATACACCAGAAAACGAGCATTTCGGAATAGTTCCTGTT
GAATGCATGTATATGAAGCGTCCTGTACTTGCTTGCAATAGTGGTGGCCCAAAGGAGAGT
GTTGTTGATGGTGAAACAGGATTTCTTTTATAAAGTAATCCATCCGATTGGTCAAAAAAA
ATGGATTGGATTGCTAAGAATCCCTCTAAAGCAGCTGAGATGGGACAAAACGGCAGAAAG
AGGGCTATCGAAAAGTTTGGATTGGAAGCATTTGCTGAATCTATCGATAAGAGTGTGAGA
GAAATTTGCTAACCAGGCTCTAAAAAGAACAATTGA


>TTHERM_00335960(protein)
MSESKSQLRIGFIHPDLGIGGAEQLIVNMAVALKKQGHNVIIYTPYHDPKHCFQATIDGT
IPVEVRGAIVPQTIFGKLWALCATIRVIFCTLYLICFGFKFDVVIVDQVSPAVPLLRLFN
RKCLFYCHYPDKLLCVERRSILKKIYRFFLDYIEEFSLLFANKILVNSNFTREVYQRSFK
YLSKYNNPEILYPAIDFSSFDDTIKQSAPVDSKASPFFLSLNRYERKKNINLAIQAFAQF
VKESASNNQFKLIIAGGYDERIAENVEHHKELLSLAKELNVEDKVVFKFSISNKERTQLL
QTAQAVLYTPENEHFGIVPVECMYMKRPVLACNSGGPKESVVDGETGFLLQSNPSDWSKK
MDWIAKNPSKAAEMGQNGRKRAIEKFGLEAFAESIDKSVREICQPGSKKNN


>TTHERM_00335960(gene)
ATGTCAGAAAGTAAATCTTAGTTGAGAATAGGATTTATTCATCCTGATTTAGGTATAGGA
GGAGCTGAATAATTAATAGTTAATATGGCTGTTGCTCTTAAAAAGTAAGGGCATAATGTA
ATTATCTACACTCCATATCATGATCCTAAGCACTGCTTTTAAGCAACAATAGATGGAACT
ATACCCGTCGAAGTGAGAGGAGCCATAGTACCTTAAACAATATTTGGTAAACTTTGGGCT
CTCTGTGCTACTATTAGAGTCATTTTTTGTACTTTATATTTGATTTGCTTTGGGTTTAAA
TTTGATGTAGTCATTGTAGATTAGGTAAAAATACATTTTGTTAAATATGGATTTATTAAG
TCAGAGATTAGTATTGAAAAAATATTAAATAAGTTGAAACAATATAATAAATAATTAAAA
ATGCTATCTATTTGATATAAAATTAGACATGAAACATTCATTTGAATAATTTAAACAAAC
ATTTTGTTTATTATATTTCAAATATTTTGTTAATATAATTCTTTTAAAAATATAAATAAA
TAAATAAATCAGGTAAGTCCTGCAGTTCCTCTACTTCGTCTTTTCAATAGAAAATGCCTT
TTTTACTGTCATTATCCTGACAAGTTGCTCTGTGTTGAAAGAAGATCTATTTTGAAAAAG
ATATATAGATTTTTTTTAGACTACATAGAAGAATTCAGCTTATTATTTGCTAACAAAATT
TTAGTTAATAGTAATTTTACACGTGAAGTTTACTAGAGATCATTCAAATATCTTAGTAAA
TATAATAATCCTGAAATATTATATCCTGCAATAGACTTTTCAAGCTTCGATGATACTATA
AAATAATCAGCACCAGTAGATTCAAAGGCAAGCCCATTTTTCTTGTCACTCAACCGTTAT
GAACGTAAGAAAAATATTAACTTAGCTATTTAAGCATTTGCATAATTTGTCAAGGAGTCA
GCTTCTAATAATCAATTTAAGCTTATAATTGCTGGAGGATATGATGAAAGAATAGCTGAA
AATGTTGAACACCATAAGGAGTTATTGTCTCTTGCTAAAGAATTAAATGTGGAAGACAAA
GTTGTATTTAAATTTAGTATCTCAAACAAAGAAAGAACTTAATTATTATAAACTGCTCAA
GCAGTATTATATACACCAGAAAACGAGCATTTCGGAATAGTTCCTGTTGAATGCATGTAT
ATGAAGCGTCCTGTACTTGCTTGCAATAGTGGTGGCCCAAAGGAGAGTGTTGTTGATGGT
GAAACAGGATTTCTTTTATAAAGTAATCCATCCGATTGGTCAAAAAAAATGGATTGGATT
GCTAAGAATCCCTCTAAAGCAGCTGAGATGGGACAAAACGGCAGAAAGAGGGCTATCGAA
AAGTTTGGATTGGAAGCATTTGCTGAATCTATCGATAAGAGTGTGAGAGAAATTTGCTAA
CCAGGCTCTAAAAAGAACAATTGA